BLASTX nr result
ID: Rehmannia26_contig00015757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00015757 (300 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY07271.1| Glycerol-3-phosphate acyltransferase 6 [Theobroma... 56 4e-06 gb|AEI25541.1| phospholipid/glycerol acyltransferase [Helianthus... 55 1e-05 >gb|EOY07271.1| Glycerol-3-phosphate acyltransferase 6 [Theobroma cacao] Length = 503 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -3 Query: 298 FECTNLTRKDKYVMMAGTDGRVQSKKENGCEEK 200 FECTNLTRKDKY MMAGTDGRV SKKE E++ Sbjct: 469 FECTNLTRKDKYAMMAGTDGRVPSKKEKEQEKE 501 >gb|AEI25541.1| phospholipid/glycerol acyltransferase [Helianthus annuus] Length = 497 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -3 Query: 298 FECTNLTRKDKYVMMAGTDGRVQSKK 221 FECTNLTRKDKYVMMAGTDGRV++KK Sbjct: 467 FECTNLTRKDKYVMMAGTDGRVETKK 492