BLASTX nr result
ID: Rehmannia26_contig00015632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00015632 (335 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004233048.1| PREDICTED: WD repeat-containing protein 53-l... 71 1e-10 ref|XP_006467618.1| PREDICTED: WD repeat-containing protein 53-l... 69 6e-10 ref|XP_006449538.1| hypothetical protein CICLE_v10015641mg [Citr... 69 6e-10 ref|XP_002316814.2| transducin family protein [Populus trichocar... 67 2e-09 emb|CBI30713.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_006358142.1| PREDICTED: cellulose synthase A catalytic su... 67 3e-09 ref|NP_974892.1| transducin/WD40 domain-containing protein [Arab... 67 3e-09 ref|NP_568648.1| transducin/WD40 domain-containing protein [Arab... 67 3e-09 dbj|BAB09218.1| unnamed protein product [Arabidopsis thaliana] 67 3e-09 gb|AAM67274.1| unknown [Arabidopsis thaliana] 67 3e-09 gb|ESW31467.1| hypothetical protein PHAVU_002G240300g [Phaseolus... 66 5e-09 gb|EOY27950.1| Transducin/WD40 repeat-like superfamily protein i... 66 5e-09 gb|EOY27949.1| Transducin/WD40 repeat-like superfamily protein i... 66 5e-09 gb|EOY27948.1| Transducin/WD40 repeat-like superfamily protein i... 66 5e-09 gb|ACD56645.1| putative G-protein beta [Gossypioides kirkii] 66 5e-09 ref|XP_006398261.1| hypothetical protein EUTSA_v10000923mg [Eutr... 65 9e-09 ref|XP_002865226.1| transducin family protein [Arabidopsis lyrat... 65 9e-09 gb|EPS67361.1| hypothetical protein M569_07414, partial [Genlise... 65 1e-08 ref|XP_006280695.1| hypothetical protein CARUB_v10026658mg [Caps... 65 1e-08 ref|XP_004287563.1| PREDICTED: WD repeat-containing protein 53-l... 65 1e-08 >ref|XP_004233048.1| PREDICTED: WD repeat-containing protein 53-like [Solanum lycopersicum] Length = 374 Score = 71.2 bits (173), Expect = 1e-10 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +3 Query: 6 DLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTIG 128 D LC ++SL +KVNWLCTT +DSENL+VCDTSK+VKVY IG Sbjct: 334 DFLCSSLSLSRKVNWLCTTPTDSENLIVCDTSKIVKVYNIG 374 >ref|XP_006467618.1| PREDICTED: WD repeat-containing protein 53-like [Citrus sinensis] Length = 375 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +3 Query: 3 DDLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 +DLL NI+L KKVNWLCTT ++SENLVVCDTSKVVKVY+I Sbjct: 334 NDLLIKNINLNKKVNWLCTTPTESENLVVCDTSKVVKVYSI 374 >ref|XP_006449538.1| hypothetical protein CICLE_v10015641mg [Citrus clementina] gi|557552149|gb|ESR62778.1| hypothetical protein CICLE_v10015641mg [Citrus clementina] Length = 375 Score = 68.9 bits (167), Expect = 6e-10 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = +3 Query: 3 DDLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 +DLL NI+L KKVNWLCTT ++SENLVVCDTSKVVKVY+I Sbjct: 334 NDLLIKNINLNKKVNWLCTTPTESENLVVCDTSKVVKVYSI 374 >ref|XP_002316814.2| transducin family protein [Populus trichocarpa] gi|550327845|gb|EEE97426.2| transducin family protein [Populus trichocarpa] Length = 343 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +3 Query: 6 DLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 D+L NI+L KKVNWLCTT +DSENLVVCDT+KVVKVY++ Sbjct: 303 DVLRLNINLSKKVNWLCTTPTDSENLVVCDTTKVVKVYSV 342 >emb|CBI30713.3| unnamed protein product [Vitis vinifera] Length = 355 Score = 67.0 bits (162), Expect = 2e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +3 Query: 3 DDLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 +D+L NI+L KKVNWLCTT +DSENLVVCDT+KVVKV+T+ Sbjct: 314 NDVLHLNINLSKKVNWLCTTPADSENLVVCDTTKVVKVHTV 354 >ref|XP_006358142.1| PREDICTED: cellulose synthase A catalytic subunit 8 [UDP-forming]-like [Solanum tuberosum] Length = 1357 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 6 DLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTIG 128 D L ++SL +KVNWLCTT +DSENL+VCDTSK+VKVY IG Sbjct: 334 DFLRSSLSLSRKVNWLCTTPTDSENLIVCDTSKIVKVYNIG 374 >ref|NP_974892.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|332007911|gb|AED95294.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Length = 334 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 6 DLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 DLL NI+L KKVNWLCT SDSENLVVCDT++VVKVY+I Sbjct: 294 DLLHLNINLSKKVNWLCTNQSDSENLVVCDTTRVVKVYSI 333 >ref|NP_568648.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|332007910|gb|AED95293.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Length = 360 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 6 DLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 DLL NI+L KKVNWLCT SDSENLVVCDT++VVKVY+I Sbjct: 320 DLLHLNINLSKKVNWLCTNQSDSENLVVCDTTRVVKVYSI 359 >dbj|BAB09218.1| unnamed protein product [Arabidopsis thaliana] Length = 352 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 6 DLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 DLL NI+L KKVNWLCT SDSENLVVCDT++VVKVY+I Sbjct: 312 DLLHLNINLSKKVNWLCTNQSDSENLVVCDTTRVVKVYSI 351 >gb|AAM67274.1| unknown [Arabidopsis thaliana] Length = 360 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +3 Query: 6 DLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 DLL NI+L KKVNWLCT SDSENLVVCDT++VVKVY+I Sbjct: 320 DLLHLNINLSKKVNWLCTNQSDSENLVVCDTTRVVKVYSI 359 >gb|ESW31467.1| hypothetical protein PHAVU_002G240300g [Phaseolus vulgaris] gi|561032889|gb|ESW31468.1| hypothetical protein PHAVU_002G240300g [Phaseolus vulgaris] Length = 387 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +3 Query: 3 DDLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 +D+L NI + +KVNWLCTT++D+ENLVVCDTSKVVKVY+I Sbjct: 346 NDILHLNIEVPRKVNWLCTTSADTENLVVCDTSKVVKVYSI 386 >gb|EOY27950.1| Transducin/WD40 repeat-like superfamily protein isoform 3 [Theobroma cacao] Length = 325 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +3 Query: 3 DDLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 ++LL NI+L KKVNWLCTT ++S+NLVVCDT+KVVKVYT+ Sbjct: 284 NELLHLNINLSKKVNWLCTTPAESDNLVVCDTTKVVKVYTV 324 >gb|EOY27949.1| Transducin/WD40 repeat-like superfamily protein isoform 2 [Theobroma cacao] Length = 375 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +3 Query: 3 DDLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 ++LL NI+L KKVNWLCTT ++S+NLVVCDT+KVVKVYT+ Sbjct: 334 NELLHLNINLSKKVNWLCTTPAESDNLVVCDTTKVVKVYTV 374 >gb|EOY27948.1| Transducin/WD40 repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 374 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +3 Query: 3 DDLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 ++LL NI+L KKVNWLCTT ++S+NLVVCDT+KVVKVYT+ Sbjct: 333 NELLHLNINLSKKVNWLCTTPAESDNLVVCDTTKVVKVYTV 373 >gb|ACD56645.1| putative G-protein beta [Gossypioides kirkii] Length = 355 Score = 65.9 bits (159), Expect = 5e-09 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +3 Query: 3 DDLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 ++LL NI+L KKVNWLCTT ++S+NLVVCDT+KVVKVYT+ Sbjct: 314 NELLHLNINLTKKVNWLCTTPAESDNLVVCDTTKVVKVYTV 354 >ref|XP_006398261.1| hypothetical protein EUTSA_v10000923mg [Eutrema salsugineum] gi|557099350|gb|ESQ39714.1| hypothetical protein EUTSA_v10000923mg [Eutrema salsugineum] Length = 384 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +3 Query: 6 DLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 DL+ N+ L KKVNWLCT SDSENLVVCDT++VVKVY+I Sbjct: 344 DLVHLNVDLNKKVNWLCTNQSDSENLVVCDTTRVVKVYSI 383 >ref|XP_002865226.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297311061|gb|EFH41485.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Length = 358 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 6 DLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 D L NI+L KKVNWLCT SDSENLVVCDT++VVKVY+I Sbjct: 318 DFLHLNINLSKKVNWLCTNQSDSENLVVCDTTRVVKVYSI 357 >gb|EPS67361.1| hypothetical protein M569_07414, partial [Genlisea aurea] Length = 362 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 3 DDLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 D++L +I L++KVNW+CTT DSENLVVCDTSK VKVYT+ Sbjct: 322 DNILRLDIGLQRKVNWICTTPCDSENLVVCDTSKTVKVYTV 362 >ref|XP_006280695.1| hypothetical protein CARUB_v10026658mg [Capsella rubella] gi|482549399|gb|EOA13593.1| hypothetical protein CARUB_v10026658mg [Capsella rubella] Length = 359 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +3 Query: 6 DLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 D L NI+L KKVNWLCT SDSENLVVCDT++VVKVY+I Sbjct: 319 DFLHFNINLSKKVNWLCTNQSDSENLVVCDTTRVVKVYSI 358 >ref|XP_004287563.1| PREDICTED: WD repeat-containing protein 53-like [Fragaria vesca subsp. vesca] Length = 375 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 6 DLLCCNISLRKKVNWLCTTTSDSENLVVCDTSKVVKVYTI 125 DLL NI+ KKVNWLCTT +D+ENLVVCDT+KVVKVY++ Sbjct: 335 DLLHLNINHNKKVNWLCTTPADTENLVVCDTTKVVKVYSV 374