BLASTX nr result
ID: Rehmannia26_contig00015335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00015335 (425 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276157.2| PREDICTED: clathrin interactor EPSIN 1-like ... 95 1e-17 emb|CBI20607.3| unnamed protein product [Vitis vinifera] 95 1e-17 ref|XP_002276103.1| PREDICTED: clathrin interactor EPSIN 1-like ... 95 1e-17 gb|ESW32966.1| hypothetical protein PHAVU_001G032700g [Phaseolus... 94 1e-17 ref|XP_004291011.1| PREDICTED: clathrin interactor EPSIN 1-like ... 92 9e-17 gb|EMJ23497.1| hypothetical protein PRUPE_ppa003357mg [Prunus pe... 91 1e-16 ref|XP_003544513.1| PREDICTED: clathrin interactor EPSIN 1-like ... 91 1e-16 ref|XP_003550292.1| PREDICTED: clathrin interactor EPSIN 1 isofo... 90 3e-16 ref|XP_004498931.1| PREDICTED: clathrin interactor EPSIN 1-like ... 89 6e-16 ref|XP_006450772.1| hypothetical protein CICLE_v10007888mg [Citr... 86 4e-15 ref|XP_006450769.1| hypothetical protein CICLE_v10007888mg [Citr... 86 4e-15 ref|XP_004142914.1| PREDICTED: clathrin interactor EPSIN 1-like ... 86 4e-15 gb|AFK49429.1| unknown [Lotus japonicus] 85 9e-15 gb|EXB66907.1| hypothetical protein L484_019545 [Morus notabilis] 85 1e-14 ref|XP_006475977.1| PREDICTED: clathrin interactor EPSIN 1-like ... 82 6e-14 ref|XP_002309523.1| hypothetical protein POPTR_0006s25050g [Popu... 82 1e-13 ref|XP_006355310.1| PREDICTED: clathrin interactor EPSIN 1-like ... 81 2e-13 ref|XP_004245127.1| PREDICTED: clathrin interactor EPSIN 1-like ... 81 2e-13 ref|XP_006340249.1| PREDICTED: clathrin interactor EPSIN 1-like ... 80 2e-13 ref|XP_004251416.1| PREDICTED: clathrin interactor EPSIN 1-like ... 80 2e-13 >ref|XP_002276157.2| PREDICTED: clathrin interactor EPSIN 1-like isoform 2 [Vitis vinifera] Length = 552 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/55 (78%), Positives = 53/55 (96%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI+APKK+NLADVGIVGGL+DGS+E++KGP +FSMG+AMG+GSG+GKS Sbjct: 467 RGLIDLNISAPKKINLADVGIVGGLSDGSDEREKGPQTSFSMGQAMGIGSGLGKS 521 >emb|CBI20607.3| unnamed protein product [Vitis vinifera] Length = 608 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/55 (78%), Positives = 53/55 (96%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI+APKK+NLADVGIVGGL+DGS+E++KGP +FSMG+AMG+GSG+GKS Sbjct: 523 RGLIDLNISAPKKINLADVGIVGGLSDGSDEREKGPQTSFSMGQAMGIGSGLGKS 577 >ref|XP_002276103.1| PREDICTED: clathrin interactor EPSIN 1-like isoform 1 [Vitis vinifera] Length = 565 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/55 (78%), Positives = 53/55 (96%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI+APKK+NLADVGIVGGL+DGS+E++KGP +FSMG+AMG+GSG+GKS Sbjct: 480 RGLIDLNISAPKKINLADVGIVGGLSDGSDEREKGPQTSFSMGQAMGIGSGLGKS 534 >gb|ESW32966.1| hypothetical protein PHAVU_001G032700g [Phaseolus vulgaris] Length = 563 Score = 94.4 bits (233), Expect = 1e-17 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVG 266 RGLIDLNITAPKKVNLADVGIVGGL+DGS+EK+KGP P+F MGRAMG GSG+G Sbjct: 478 RGLIDLNITAPKKVNLADVGIVGGLSDGSDEKEKGPPPSFFMGRAMGSGSGLG 530 >ref|XP_004291011.1| PREDICTED: clathrin interactor EPSIN 1-like [Fragaria vesca subsp. vesca] Length = 577 Score = 91.7 bits (226), Expect = 9e-17 Identities = 43/55 (78%), Positives = 50/55 (90%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNIT PKKVNLADVGIVGGLTDG++E++KGP +F+MGRAMG G G+GKS Sbjct: 496 RGLIDLNITGPKKVNLADVGIVGGLTDGADEREKGPPTSFNMGRAMGSGMGLGKS 550 >gb|EMJ23497.1| hypothetical protein PRUPE_ppa003357mg [Prunus persica] Length = 582 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/55 (78%), Positives = 51/55 (92%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI+APKKVNLADVGIVGGLTDGS+E++KGP ++ MGRAMG G+G+GKS Sbjct: 496 RGLIDLNISAPKKVNLADVGIVGGLTDGSDEREKGPPTSYYMGRAMGSGTGLGKS 550 >ref|XP_003544513.1| PREDICTED: clathrin interactor EPSIN 1-like isoform 1 [Glycine max] Length = 564 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVG 266 RGLIDLNITAPKKV+LADVGIVGGL+DGS+E++KGP P+F MGRAMG GSG+G Sbjct: 479 RGLIDLNITAPKKVSLADVGIVGGLSDGSDEREKGPPPSFYMGRAMGSGSGLG 531 >ref|XP_003550292.1| PREDICTED: clathrin interactor EPSIN 1 isoform 1 [Glycine max] Length = 564 Score = 89.7 bits (221), Expect = 3e-16 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVG 266 RGLIDLNITAPKKV+L DVGIVGGL+DGS+E++KGP P+F MGRAMG GSG+G Sbjct: 479 RGLIDLNITAPKKVSLVDVGIVGGLSDGSDEREKGPPPSFYMGRAMGSGSGLG 531 >ref|XP_004498931.1| PREDICTED: clathrin interactor EPSIN 1-like [Cicer arietinum] Length = 559 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI+APKKV+L DVGIVGGL+DGS+EK+KGP TF MGRAMG GSG+G S Sbjct: 476 RGLIDLNISAPKKVSLVDVGIVGGLSDGSDEKEKGPPTTFYMGRAMGSGSGLGMS 530 >ref|XP_006450772.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] gi|557553998|gb|ESR64012.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] Length = 507 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/55 (70%), Positives = 50/55 (90%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RG+IDLNI+APKKV+LADVG+VGGL+DGS+E++KGP +F MGRAMG G+G+ KS Sbjct: 425 RGIIDLNISAPKKVSLADVGVVGGLSDGSDEREKGPPTSFYMGRAMGTGTGLSKS 479 >ref|XP_006450769.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] gi|567917528|ref|XP_006450770.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] gi|567917530|ref|XP_006450771.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] gi|557553995|gb|ESR64009.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] gi|557553996|gb|ESR64010.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] gi|557553997|gb|ESR64011.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] Length = 561 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/55 (70%), Positives = 50/55 (90%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RG+IDLNI+APKKV+LADVG+VGGL+DGS+E++KGP +F MGRAMG G+G+ KS Sbjct: 479 RGIIDLNISAPKKVSLADVGVVGGLSDGSDEREKGPPTSFYMGRAMGTGTGLSKS 533 >ref|XP_004142914.1| PREDICTED: clathrin interactor EPSIN 1-like [Cucumis sativus] Length = 621 Score = 86.3 bits (212), Expect = 4e-15 Identities = 38/55 (69%), Positives = 50/55 (90%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI+APKKV+L DVG+VGGL+D S+E++KGP PT+ MG+AMG GSG+G++ Sbjct: 542 RGLIDLNISAPKKVSLVDVGVVGGLSDFSDEREKGPAPTYHMGQAMGAGSGLGRT 596 >gb|AFK49429.1| unknown [Lotus japonicus] Length = 113 Score = 85.1 bits (209), Expect = 9e-15 Identities = 43/56 (76%), Positives = 50/56 (89%), Gaps = 1/56 (1%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKG-PLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI+APKKV+LADVGIVGGL+DG +EK+KG P P+F MGRAMG GSG+G S Sbjct: 31 RGLIDLNISAPKKVSLADVGIVGGLSDGFDEKEKGTPPPSFYMGRAMGSGSGLGMS 86 >gb|EXB66907.1| hypothetical protein L484_019545 [Morus notabilis] Length = 578 Score = 84.7 bits (208), Expect = 1e-14 Identities = 38/55 (69%), Positives = 49/55 (89%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI+APKKV+L DVG+VGGL++G +EK+KGP ++ MGRAMG GSG+G+S Sbjct: 496 RGLIDLNISAPKKVSLVDVGVVGGLSEGLDEKEKGPATSYYMGRAMGAGSGLGRS 550 >ref|XP_006475977.1| PREDICTED: clathrin interactor EPSIN 1-like isoform X1 [Citrus sinensis] gi|568844191|ref|XP_006475978.1| PREDICTED: clathrin interactor EPSIN 1-like isoform X2 [Citrus sinensis] Length = 561 Score = 82.4 bits (202), Expect = 6e-14 Identities = 38/55 (69%), Positives = 48/55 (87%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RG+IDLNI+A KKV+LADVG+VGGL+DGS+E++KGP +F MGRAMG G+G KS Sbjct: 479 RGIIDLNISASKKVSLADVGVVGGLSDGSDEREKGPPTSFYMGRAMGTGTGFSKS 533 >ref|XP_002309523.1| hypothetical protein POPTR_0006s25050g [Populus trichocarpa] gi|118485167|gb|ABK94445.1| unknown [Populus trichocarpa] gi|222855499|gb|EEE93046.1| hypothetical protein POPTR_0006s25050g [Populus trichocarpa] Length = 559 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/55 (69%), Positives = 48/55 (87%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI+APKKV+L DVG+VG LT+G +E++KGP +F MG AMG+GSG+GKS Sbjct: 475 RGLIDLNISAPKKVSLVDVGVVGDLTNGLDEREKGPPTSFYMGTAMGMGSGLGKS 529 >ref|XP_006355310.1| PREDICTED: clathrin interactor EPSIN 1-like isoform X2 [Solanum tuberosum] Length = 551 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI+APKKVNLADVG+VGGLTDGS+E++KGP +F +AMG G G GKS Sbjct: 470 RGLIDLNISAPKKVNLADVGVVGGLTDGSDEREKGP-TSFYSSKAMGQGIGYGKS 523 >ref|XP_004245127.1| PREDICTED: clathrin interactor EPSIN 1-like [Solanum lycopersicum] Length = 553 Score = 80.9 bits (198), Expect = 2e-13 Identities = 40/55 (72%), Positives = 47/55 (85%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI+APKKVNLADVG+VGGLTDGS+E++KGP +F +AMG G G GKS Sbjct: 472 RGLIDLNISAPKKVNLADVGVVGGLTDGSDEREKGP-TSFYSSKAMGQGIGYGKS 525 >ref|XP_006340249.1| PREDICTED: clathrin interactor EPSIN 1-like [Solanum tuberosum] Length = 546 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/55 (74%), Positives = 47/55 (85%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI AP KVNLADVGI+GGLTDGS+ K+KGP TF MGRAMG G+ +G+S Sbjct: 467 RGLIDLNIAAPTKVNLADVGIMGGLTDGSDGKEKGP-TTFYMGRAMGQGTKLGQS 520 >ref|XP_004251416.1| PREDICTED: clathrin interactor EPSIN 1-like [Solanum lycopersicum] Length = 537 Score = 80.5 bits (197), Expect = 2e-13 Identities = 41/55 (74%), Positives = 47/55 (85%) Frame = -2 Query: 424 RGLIDLNITAPKKVNLADVGIVGGLTDGSEEKDKGPLPTFSMGRAMGVGSGVGKS 260 RGLIDLNI AP KVNLADVGI+GGLTDGS+ K+KGP TF MGRAMG G+ +G+S Sbjct: 458 RGLIDLNIAAPTKVNLADVGIMGGLTDGSDGKEKGP-TTFYMGRAMGQGTKLGQS 511