BLASTX nr result
ID: Rehmannia26_contig00015282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00015282 (411 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514350.1| ATP-binding cassette transporter, putative [... 99 8e-19 gb|EOY26620.1| Pleiotropic drug resistance 12 [Theobroma cacao] 98 1e-18 gb|EOY26443.1| Pleiotropic drug resistance 12 [Theobroma cacao] 97 2e-18 ref|XP_002514351.1| ATP-binding cassette transporter, putative [... 97 2e-18 ref|XP_006427136.1| hypothetical protein CICLE_v10024709mg [Citr... 97 3e-18 ref|XP_006465417.1| PREDICTED: pleiotropic drug resistance prote... 96 4e-18 emb|CBI20978.3| unnamed protein product [Vitis vinifera] 96 5e-18 emb|CAN80954.1| hypothetical protein VITISV_032205 [Vitis vinifera] 96 5e-18 ref|XP_006466163.1| PREDICTED: pleiotropic drug resistance prote... 96 6e-18 ref|XP_006441387.1| hypothetical protein CICLE_v10018487mg [Citr... 96 6e-18 gb|EPS71654.1| hypothetical protein M569_03105, partial [Genlise... 96 6e-18 ref|XP_002324840.1| hypothetical protein POPTR_0018s01240g [Popu... 95 8e-18 sp|Q76CU2.1|PDR1_TOBAC RecName: Full=Pleiotropic drug resistance... 95 1e-17 dbj|BAB92011.1| pleiotropic drug resistance like protein [Nicoti... 95 1e-17 ref|XP_006466162.1| PREDICTED: pleiotropic drug resistance prote... 94 2e-17 dbj|BAD07484.1| PDR-type ABC transporter 2 [Nicotiana tabacum] 94 2e-17 ref|XP_002303856.2| hypothetical protein POPTR_0003s18140g [Popu... 94 2e-17 ref|XP_006465411.1| PREDICTED: pleiotropic drug resistance prote... 93 3e-17 ref|XP_006427145.1| hypothetical protein CICLE_v10024697mg [Citr... 93 3e-17 gb|AGN95757.1| PDR1-like protein, partial [Nicotiana plumbaginif... 93 3e-17 >ref|XP_002514350.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223546806|gb|EEF48304.1| ATP-binding cassette transporter, putative [Ricinus communis] Length = 1449 Score = 98.6 bits (244), Expect = 8e-19 Identities = 37/51 (72%), Positives = 48/51 (94%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 P+WWRWY+WA P+AWTLYGLVASQFGD+++ELDT ++V+ F+RSYFGF+HD Sbjct: 1367 PIWWRWYYWACPIAWTLYGLVASQFGDIKEELDTGETVEHFLRSYFGFQHD 1417 >gb|EOY26620.1| Pleiotropic drug resistance 12 [Theobroma cacao] Length = 1446 Score = 98.2 bits (243), Expect = 1e-18 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRWY+WA P+AWTLYGL SQFGDV+D LDT ++VQ F+RSY+GFRHD Sbjct: 1364 PVWWRWYYWACPLAWTLYGLTTSQFGDVKDTLDTNETVQSFIRSYYGFRHD 1414 >gb|EOY26443.1| Pleiotropic drug resistance 12 [Theobroma cacao] Length = 1477 Score = 97.4 bits (241), Expect = 2e-18 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRWY W +P+AWTLYGL+ASQFGDV+D LDT ++VQ F+RS++GFRHD Sbjct: 1395 PVWWRWYSWTSPLAWTLYGLIASQFGDVKDMLDTNETVQSFIRSHYGFRHD 1445 >ref|XP_002514351.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223546807|gb|EEF48305.1| ATP-binding cassette transporter, putative [Ricinus communis] Length = 1438 Score = 97.4 bits (241), Expect = 2e-18 Identities = 38/51 (74%), Positives = 46/51 (90%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRWY+W PVAWT+YGLVASQFGD++D LDT ++V+ F+RSYFGFRHD Sbjct: 1356 PVWWRWYYWCCPVAWTMYGLVASQFGDIKDMLDTGETVEHFLRSYFGFRHD 1406 >ref|XP_006427136.1| hypothetical protein CICLE_v10024709mg [Citrus clementina] gi|557529126|gb|ESR40376.1| hypothetical protein CICLE_v10024709mg [Citrus clementina] Length = 1444 Score = 96.7 bits (239), Expect = 3e-18 Identities = 36/51 (70%), Positives = 46/51 (90%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRWY+WANPVAWTLYGL+ASQFGDV D+++ ++V+ F+R YFGF+HD Sbjct: 1362 PVWWRWYYWANPVAWTLYGLIASQFGDVEDQMENGETVKHFLRDYFGFKHD 1412 >ref|XP_006465417.1| PREDICTED: pleiotropic drug resistance protein 1-like [Citrus sinensis] Length = 1444 Score = 96.3 bits (238), Expect = 4e-18 Identities = 35/51 (68%), Positives = 46/51 (90%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRWY+WANP+AWTLYGL+ASQFGDV D+++ ++V+ F+R YFGF+HD Sbjct: 1362 PVWWRWYYWANPIAWTLYGLIASQFGDVEDQMENGETVKHFLRDYFGFKHD 1412 >emb|CBI20978.3| unnamed protein product [Vitis vinifera] Length = 1436 Score = 95.9 bits (237), Expect = 5e-18 Identities = 35/51 (68%), Positives = 47/51 (92%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRWY+W P++WTLYGL+ SQFGD++D+LDT ++++DFVRSYFGFR+D Sbjct: 1354 PVWWRWYYWCCPISWTLYGLIGSQFGDMKDKLDTGETIEDFVRSYFGFRND 1404 >emb|CAN80954.1| hypothetical protein VITISV_032205 [Vitis vinifera] Length = 1441 Score = 95.9 bits (237), Expect = 5e-18 Identities = 35/51 (68%), Positives = 47/51 (92%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRWY+W P++WTLYGL+ SQFGD++D+LDT ++++DFVRSYFGFR+D Sbjct: 1359 PVWWRWYYWCCPISWTLYGLIGSQFGDMKDKLDTGETIEDFVRSYFGFRND 1409 >ref|XP_006466163.1| PREDICTED: pleiotropic drug resistance protein 1-like [Citrus sinensis] Length = 1461 Score = 95.5 bits (236), Expect = 6e-18 Identities = 36/51 (70%), Positives = 47/51 (92%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 P+WWRWY+WANPVAWT+YGLVASQFGDV D++++ ++V+ FVRSYF F+HD Sbjct: 1379 PLWWRWYYWANPVAWTMYGLVASQFGDVEDKMESGETVKQFVRSYFDFKHD 1429 >ref|XP_006441387.1| hypothetical protein CICLE_v10018487mg [Citrus clementina] gi|557543649|gb|ESR54627.1| hypothetical protein CICLE_v10018487mg [Citrus clementina] Length = 1455 Score = 95.5 bits (236), Expect = 6e-18 Identities = 36/51 (70%), Positives = 47/51 (92%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 P+WWRWY+WANPVAWT+YGLVASQFGDV D++++ ++V+ FVRSYF F+HD Sbjct: 1373 PLWWRWYYWANPVAWTMYGLVASQFGDVEDKMESGETVKQFVRSYFDFKHD 1423 >gb|EPS71654.1| hypothetical protein M569_03105, partial [Genlisea aurea] Length = 1382 Score = 95.5 bits (236), Expect = 6e-18 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRW+HW NPVAW+LYGLV+SQFGDV ++T +SV+DFV SYFGF HD Sbjct: 1300 PVWWRWFHWVNPVAWSLYGLVSSQFGDVSARMETGESVEDFVESYFGFHHD 1350 >ref|XP_002324840.1| hypothetical protein POPTR_0018s01240g [Populus trichocarpa] gi|222866274|gb|EEF03405.1| hypothetical protein POPTR_0018s01240g [Populus trichocarpa] Length = 1429 Score = 95.1 bits (235), Expect = 8e-18 Identities = 34/51 (66%), Positives = 47/51 (92%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 P+WWRWY WA P++WTLYGL+ASQ+GD++D+L+ ++V+DFVR+YFGFRHD Sbjct: 1347 PIWWRWYFWACPISWTLYGLIASQYGDIKDKLEGDETVEDFVRNYFGFRHD 1397 >sp|Q76CU2.1|PDR1_TOBAC RecName: Full=Pleiotropic drug resistance protein 1; AltName: Full=NtPDR1 gi|41052472|dbj|BAD07483.1| PDR-type ABC transporter 1 [Nicotiana tabacum] Length = 1434 Score = 94.7 bits (234), Expect = 1e-17 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRWY+WANPVAWTLYGLVASQFGD++ +L ++V+ F+R YFGF+HD Sbjct: 1352 PVWWRWYYWANPVAWTLYGLVASQFGDIQTKLSDNETVEQFLRRYFGFKHD 1402 >dbj|BAB92011.1| pleiotropic drug resistance like protein [Nicotiana tabacum] Length = 1434 Score = 94.7 bits (234), Expect = 1e-17 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRWY+WANPVAWTLYGLVASQFGD++ +L ++V+ F+R YFGF+HD Sbjct: 1352 PVWWRWYYWANPVAWTLYGLVASQFGDIQTKLSDNETVEQFLRRYFGFKHD 1402 >ref|XP_006466162.1| PREDICTED: pleiotropic drug resistance protein 1-like [Citrus sinensis] Length = 1566 Score = 94.0 bits (232), Expect = 2e-17 Identities = 35/51 (68%), Positives = 47/51 (92%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 P+WWRWY+WANPVAWT+YGLVASQFGDV D++++ ++V+ FVRSYF F+H+ Sbjct: 1484 PLWWRWYYWANPVAWTMYGLVASQFGDVEDKMESGETVKQFVRSYFDFKHE 1534 >dbj|BAD07484.1| PDR-type ABC transporter 2 [Nicotiana tabacum] Length = 1078 Score = 94.0 bits (232), Expect = 2e-17 Identities = 36/51 (70%), Positives = 44/51 (86%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRWY+WANPVAWTLYGLVASQFGD++ L ++V+ F+R YFGF+HD Sbjct: 996 PVWWRWYYWANPVAWTLYGLVASQFGDIQTTLSDNETVEQFLRRYFGFKHD 1046 >ref|XP_002303856.2| hypothetical protein POPTR_0003s18140g [Populus trichocarpa] gi|550343433|gb|EEE78835.2| hypothetical protein POPTR_0003s18140g [Populus trichocarpa] Length = 1400 Score = 93.6 bits (231), Expect = 2e-17 Identities = 35/51 (68%), Positives = 47/51 (92%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRWY W PV+WTLYGLV+SQFGD++++LDT ++V+DFVR+YFGF+H+ Sbjct: 1318 PVWWRWYAWICPVSWTLYGLVSSQFGDIKEKLDTGETVEDFVRNYFGFKHE 1368 >ref|XP_006465411.1| PREDICTED: pleiotropic drug resistance protein 1-like [Citrus sinensis] Length = 1445 Score = 93.2 bits (230), Expect = 3e-17 Identities = 34/51 (66%), Positives = 47/51 (92%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 P+WWRWY+WA PV+WTLYGLVASQFGD++D L++ ++V+ F+RS+FGF+HD Sbjct: 1363 PIWWRWYYWACPVSWTLYGLVASQFGDIQDRLESGETVEQFLRSFFGFKHD 1413 >ref|XP_006427145.1| hypothetical protein CICLE_v10024697mg [Citrus clementina] gi|557529135|gb|ESR40385.1| hypothetical protein CICLE_v10024697mg [Citrus clementina] Length = 1528 Score = 93.2 bits (230), Expect = 3e-17 Identities = 34/51 (66%), Positives = 47/51 (92%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 P+WWRWY+WA PV+WTLYGLVASQFGD++D L++ ++V+ F+RS+FGF+HD Sbjct: 1446 PIWWRWYYWACPVSWTLYGLVASQFGDIQDRLESGETVEQFLRSFFGFKHD 1496 >gb|AGN95757.1| PDR1-like protein, partial [Nicotiana plumbaginifolia] Length = 373 Score = 93.2 bits (230), Expect = 3e-17 Identities = 35/51 (68%), Positives = 45/51 (88%) Frame = +1 Query: 1 PVWWRWYHWANPVAWTLYGLVASQFGDVRDELDTKQSVQDFVRSYFGFRHD 153 PVWWRWY+WANPVAWTLYGLVASQFGD++ +L ++V+ F+R +FGF+HD Sbjct: 291 PVWWRWYYWANPVAWTLYGLVASQFGDIQTKLSDNETVEQFLRRFFGFKHD 341