BLASTX nr result
ID: Rehmannia26_contig00014763
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00014763 (378 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ13292.1| hypothetical protein PRUPE_ppa005108mg [Prunus pe... 59 7e-07 >gb|EMJ13292.1| hypothetical protein PRUPE_ppa005108mg [Prunus persica] Length = 477 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 3/68 (4%) Frame = +3 Query: 165 YVIEINSDYYREGTCESNGVDEAIAWAKEKFQTPYREEGKCVMQECGTEKST---QGSKM 335 YVIEINS++ REGTCE+ G++EAIAWAKEKFQT E + + + E+S Q + Sbjct: 293 YVIEINSEH-REGTCEAGGIEEAIAWAKEKFQTHSNSEKEGSLTQQENEQSVGMDQEGRP 351 Query: 336 SNGHQVSE 359 +N + S+ Sbjct: 352 NNADEYSD 359