BLASTX nr result
ID: Rehmannia26_contig00014509
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00014509 (520 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006649857.1| PREDICTED: probable rhamnose biosynthetic en... 107 1e-21 gb|ACG33666.1| RHM1 [Zea mays] 107 1e-21 ref|NP_001130297.1| uncharacterized protein LOC100191391 [Zea ma... 107 1e-21 ref|NP_001049724.1| Os03g0278200 [Oryza sativa Japonica Group] g... 107 2e-21 ref|XP_004984749.1| PREDICTED: probable rhamnose biosynthetic en... 106 4e-21 gb|EMT23371.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops... 106 4e-21 gb|EMS59810.1| putative rhamnose biosynthetic enzyme 1 [Triticum... 106 4e-21 dbj|BAJ97692.1| predicted protein [Hordeum vulgare subsp. vulgare] 106 4e-21 ref|XP_003571828.1| PREDICTED: probable rhamnose biosynthetic en... 105 5e-21 ref|XP_004984748.1| PREDICTED: probable rhamnose biosynthetic en... 105 8e-21 ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic en... 105 8e-21 ref|XP_006647099.1| PREDICTED: probable rhamnose biosynthetic en... 104 1e-20 ref|XP_004303854.1| PREDICTED: probable rhamnose biosynthetic en... 104 1e-20 ref|XP_004137224.1| PREDICTED: probable rhamnose biosynthetic en... 104 1e-20 ref|XP_002468088.1| hypothetical protein SORBIDRAFT_01g039340 [S... 104 1e-20 ref|XP_006585327.1| PREDICTED: probable rhamnose biosynthetic en... 103 2e-20 ref|XP_006585326.1| PREDICTED: probable rhamnose biosynthetic en... 103 2e-20 ref|XP_003531412.1| PREDICTED: probable rhamnose biosynthetic en... 103 2e-20 ref|XP_003546628.1| PREDICTED: probable rhamnose biosynthetic en... 103 3e-20 ref|XP_002440852.1| hypothetical protein SORBIDRAFT_09g008220 [S... 103 3e-20 >ref|XP_006649857.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Oryza brachyantha] Length = 673 Score = 107 bits (268), Expect = 1e-21 Identities = 52/55 (94%), Positives = 54/55 (98%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPA 355 KWTNFTLEEQAKVIVAPRSNNEMDASKLK+EFPELLSIK+SLIKYVFEPNRK PA Sbjct: 618 KWTNFTLEEQAKVIVAPRSNNEMDASKLKSEFPELLSIKDSLIKYVFEPNRKVPA 672 >gb|ACG33666.1| RHM1 [Zea mays] Length = 666 Score = 107 bits (268), Expect = 1e-21 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPAE 352 KWTNFTLEEQAKVIVAPRSNNEMDA+KLKNEFPELLSIK+SLIKYVFEPNRK P + Sbjct: 611 KWTNFTLEEQAKVIVAPRSNNEMDATKLKNEFPELLSIKDSLIKYVFEPNRKVPTD 666 >ref|NP_001130297.1| uncharacterized protein LOC100191391 [Zea mays] gi|194688776|gb|ACF78472.1| unknown [Zea mays] gi|413944849|gb|AFW77498.1| RHM1 [Zea mays] Length = 676 Score = 107 bits (268), Expect = 1e-21 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPAE 352 KWTNFTLEEQAKVIVAPRSNNEMDA+KLKNEFPELLSIK+SLIKYVFEPNRK P + Sbjct: 621 KWTNFTLEEQAKVIVAPRSNNEMDATKLKNEFPELLSIKDSLIKYVFEPNRKVPTD 676 >ref|NP_001049724.1| Os03g0278200 [Oryza sativa Japonica Group] gi|108707482|gb|ABF95277.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa Japonica Group] gi|108707483|gb|ABF95278.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa Japonica Group] gi|108707484|gb|ABF95279.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa Japonica Group] gi|113548195|dbj|BAF11638.1| Os03g0278200 [Oryza sativa Japonica Group] gi|218192544|gb|EEC74971.1| hypothetical protein OsI_10998 [Oryza sativa Indica Group] gi|222624667|gb|EEE58799.1| hypothetical protein OsJ_10344 [Oryza sativa Japonica Group] Length = 675 Score = 107 bits (267), Expect = 2e-21 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPA 355 KWTNFTLEEQAKVIVAPRSNNEMDASKLK+EFPELLSIK+SL+KYVFEPNRK PA Sbjct: 620 KWTNFTLEEQAKVIVAPRSNNEMDASKLKSEFPELLSIKDSLVKYVFEPNRKVPA 674 >ref|XP_004984749.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria italica] Length = 672 Score = 106 bits (264), Expect = 4e-21 Identities = 52/55 (94%), Positives = 53/55 (96%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPA 355 KWTNFTLEEQAKVIVAPRSNNEMDASKLK EFPELLSIK+SLIKYVFEPNRK PA Sbjct: 617 KWTNFTLEEQAKVIVAPRSNNEMDASKLKVEFPELLSIKDSLIKYVFEPNRKVPA 671 >gb|EMT23371.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii] Length = 667 Score = 106 bits (264), Expect = 4e-21 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPA 355 KWTNFTLEEQAKVIVAPRSNNEMDA+KLK EFPELLSIK+SLIKYVFEPNRK PA Sbjct: 612 KWTNFTLEEQAKVIVAPRSNNEMDATKLKREFPELLSIKDSLIKYVFEPNRKVPA 666 >gb|EMS59810.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu] Length = 667 Score = 106 bits (264), Expect = 4e-21 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPA 355 KWTNFTLEEQAKVIVAPRSNNEMDA+KLK EFPELLSIK+SLIKYVFEPNRK PA Sbjct: 612 KWTNFTLEEQAKVIVAPRSNNEMDATKLKREFPELLSIKDSLIKYVFEPNRKVPA 666 >dbj|BAJ97692.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 667 Score = 106 bits (264), Expect = 4e-21 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPA 355 KWTNFTLEEQAKVIVAPRSNNEMDA+KLK EFPELLSIK+SLIKYVFEPNRK PA Sbjct: 612 KWTNFTLEEQAKVIVAPRSNNEMDAAKLKREFPELLSIKDSLIKYVFEPNRKVPA 666 >ref|XP_003571828.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Brachypodium distachyon] Length = 667 Score = 105 bits (263), Expect = 5e-21 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPA 355 KWTNFTLEEQAKVIVAPRSNNEMDA+KLK EFPELLSIK+SL+KYVFEPNRK PA Sbjct: 612 KWTNFTLEEQAKVIVAPRSNNEMDATKLKKEFPELLSIKDSLVKYVFEPNRKVPA 666 >ref|XP_004984748.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria italica] Length = 673 Score = 105 bits (261), Expect = 8e-21 Identities = 51/54 (94%), Positives = 52/54 (96%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTP 358 KWTNFTLEEQAKVIVAPRSNNEMDASKLK EFPELLSIK+SLIKYVFEPNRK P Sbjct: 618 KWTNFTLEEQAKVIVAPRSNNEMDASKLKAEFPELLSIKDSLIKYVFEPNRKVP 671 >ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X1 [Glycine max] gi|571494814|ref|XP_006592951.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X2 [Glycine max] Length = 669 Score = 105 bits (261), Expect = 8e-21 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKT 361 KWTNF LEEQAKVI+APRSNNEMDASKLKNEFPELLSIKESLIKYVFEPN+KT Sbjct: 616 KWTNFNLEEQAKVIIAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNKKT 668 >ref|XP_006647099.1| PREDICTED: probable rhamnose biosynthetic enzyme 3-like [Oryza brachyantha] Length = 667 Score = 104 bits (259), Expect = 1e-20 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPA 355 KW+NFTLEEQAKVIVAPRSNNEMD +KLK+EFPELLSIKESL+KYVFEPNRK PA Sbjct: 612 KWSNFTLEEQAKVIVAPRSNNEMDGTKLKDEFPELLSIKESLVKYVFEPNRKVPA 666 >ref|XP_004303854.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Fragaria vesca subsp. vesca] Length = 679 Score = 104 bits (259), Expect = 1e-20 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPA 355 KW NFTLEEQAKVIVAPRSNNEMDASKLK EFPELLSIKESLIKYVFEPN+KT A Sbjct: 620 KWVNFTLEEQAKVIVAPRSNNEMDASKLKKEFPELLSIKESLIKYVFEPNKKTSA 674 >ref|XP_004137224.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis sativus] gi|449483174|ref|XP_004156513.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis sativus] Length = 670 Score = 104 bits (259), Expect = 1e-20 Identities = 50/55 (90%), Positives = 52/55 (94%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPA 355 KW NFTLEEQAKVIVAPRSNNEMDASKLKNEFPE+L IKESLIKYVFEPN+KT A Sbjct: 616 KWANFTLEEQAKVIVAPRSNNEMDASKLKNEFPEMLGIKESLIKYVFEPNKKTSA 670 >ref|XP_002468088.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor] gi|241921942|gb|EER95086.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor] Length = 672 Score = 104 bits (259), Expect = 1e-20 Identities = 50/55 (90%), Positives = 53/55 (96%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTPA 355 KWTNFTLEEQAKVIVAPRSNNEMDASKLK EFP+LLSIK+SLIKYVFEPNRK P+ Sbjct: 617 KWTNFTLEEQAKVIVAPRSNNEMDASKLKAEFPQLLSIKDSLIKYVFEPNRKVPS 671 >ref|XP_006585327.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X3 [Glycine max] Length = 690 Score = 103 bits (257), Expect = 2e-20 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKT 361 KW+NFTLEEQAKVIVAPRSNNEMDASKLK EFPELLSIKESLIKYVFEPN+KT Sbjct: 638 KWSNFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPNKKT 690 >ref|XP_006585326.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X2 [Glycine max] Length = 691 Score = 103 bits (257), Expect = 2e-20 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKT 361 KW+NFTLEEQAKVIVAPRSNNEMDASKLK EFPELLSIKESLIKYVFEPN+KT Sbjct: 639 KWSNFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPNKKT 691 >ref|XP_003531412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X1 [Glycine max] gi|571471508|ref|XP_006585328.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X4 [Glycine max] gi|571471510|ref|XP_006585329.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X5 [Glycine max] gi|571471512|ref|XP_006585330.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X6 [Glycine max] Length = 668 Score = 103 bits (257), Expect = 2e-20 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKT 361 KW+NFTLEEQAKVIVAPRSNNEMDASKLK EFPELLSIKESLIKYVFEPN+KT Sbjct: 616 KWSNFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPNKKT 668 >ref|XP_003546628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X1 [Glycine max] gi|571520322|ref|XP_006597976.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X2 [Glycine max] gi|571520324|ref|XP_006597977.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform X3 [Glycine max] Length = 668 Score = 103 bits (256), Expect = 3e-20 Identities = 50/53 (94%), Positives = 51/53 (96%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKT 361 KW NFTLEEQAKVIVAPRSNNEMDASKLK EFPELLSIKESLIKYVFEPN+KT Sbjct: 616 KWANFTLEEQAKVIVAPRSNNEMDASKLKTEFPELLSIKESLIKYVFEPNKKT 668 >ref|XP_002440852.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor] gi|241946137|gb|EES19282.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor] Length = 666 Score = 103 bits (256), Expect = 3e-20 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = -2 Query: 519 KWTNFTLEEQAKVIVAPRSNNEMDASKLKNEFPELLSIKESLIKYVFEPNRKTP 358 KWTNFTLEEQAKVIVAPRSNNEMDA+KLK EFPELLSIK+SLIK+VFEPNRK P Sbjct: 611 KWTNFTLEEQAKVIVAPRSNNEMDATKLKKEFPELLSIKDSLIKFVFEPNRKVP 664