BLASTX nr result
ID: Rehmannia26_contig00012877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00012877 (494 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006468334.1| PREDICTED: uncharacterized protein LOC102615... 60 3e-07 ref|XP_006448871.1| hypothetical protein CICLE_v10015182mg [Citr... 59 9e-07 >ref|XP_006468334.1| PREDICTED: uncharacterized protein LOC102615656 [Citrus sinensis] Length = 456 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = +3 Query: 357 YLILCVIVLAGLIGGRVFALLLTLSWCLVLKLGEKL 464 YLILC+IVLAGL+GGRV AL+LT+SWCL LKL KL Sbjct: 414 YLILCLIVLAGLVGGRVLALVLTVSWCLALKLVAKL 449 >ref|XP_006448871.1| hypothetical protein CICLE_v10015182mg [Citrus clementina] gi|557551482|gb|ESR62111.1| hypothetical protein CICLE_v10015182mg [Citrus clementina] Length = 458 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 357 YLILCVIVLAGLIGGRVFALLLTLSWCLVLKLGEKL 464 YLILC+IVLAGL+GGRV AL+LT+SWC LKL KL Sbjct: 414 YLILCLIVLAGLVGGRVLALVLTVSWCFALKLVAKL 449