BLASTX nr result
ID: Rehmannia26_contig00012718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00012718 (598 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAZ07706.1| cytochrome P450 monooxygenase [Sesamum indicum] 57 4e-06 >gb|AAZ07706.1| cytochrome P450 monooxygenase [Sesamum indicum] Length = 514 Score = 57.0 bits (136), Expect = 4e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -1 Query: 598 KVMLPAGVEIIMPVILLHHDRQIWGDDAKDF 506 KV LPAGV+++MP +LLHHDR+IWGDDA++F Sbjct: 403 KVTLPAGVQLLMPAVLLHHDRKIWGDDAEEF 433