BLASTX nr result
ID: Rehmannia26_contig00012662
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00012662 (339 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFB18635.1| CESA6 [Gossypium hirsutum] 83 3e-14 gb|ACS88359.1| cellulose synthase catalytic subunit [Gossypium h... 83 3e-14 ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic su... 83 4e-14 gb|EOY31461.1| Cellulose synthase 1 [Theobroma cacao] 82 7e-14 gb|AGC97433.2| cellulose synthase [Boehmeria nivea] 82 1e-13 gb|AAY78952.3| cellulose synthase CesA1 [Boehmeria nivea] 82 1e-13 gb|AFZ78556.1| cellulose synthase [Populus tomentosa] 81 2e-13 ref|XP_002308657.1| cellulose synthase family protein [Populus t... 81 2e-13 gb|AAO25536.1| cellulose synthase [Populus tremuloides] 81 2e-13 gb|EMJ22782.1| hypothetical protein PRUPE_ppa000611mg [Prunus pe... 80 3e-13 ref|XP_002515536.1| Cellulose synthase A catalytic subunit 6 [UD... 80 3e-13 ref|XP_006361724.1| PREDICTED: cellulose synthase A catalytic su... 79 5e-13 ref|XP_004245031.1| PREDICTED: cellulose synthase A catalytic su... 79 5e-13 gb|AAP97497.1| cellulose synthase [Solanum tuberosum] 79 5e-13 gb|AFZ78558.1| cellulose synthase [Populus tomentosa] 78 1e-12 ref|XP_002324291.1| TGACG-motif binding family protein [Populus ... 78 1e-12 gb|EPS68064.1| hypothetical protein M569_06709, partial [Genlise... 77 2e-12 gb|AEK31219.1| cellulose synthase A [Eucalyptus camaldulensis] 77 3e-12 ref|XP_006483337.1| PREDICTED: cellulose synthase A catalytic su... 76 5e-12 ref|XP_006450469.1| hypothetical protein CICLE_v10007296mg [Citr... 76 5e-12 >gb|AFB18635.1| CESA6 [Gossypium hirsutum] Length = 1083 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTSEAT+ AA GQCG+NC Sbjct: 1042 PTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC 1083 >gb|ACS88359.1| cellulose synthase catalytic subunit [Gossypium hirsutum] Length = 657 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTSEAT+ AA GQCG+NC Sbjct: 616 PTIVIVWSILLASIFSLLWVRIDPFTSEATKAAANGQCGINC 657 >ref|XP_004291468.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Fragaria vesca subsp. vesca] Length = 1069 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/42 (90%), Positives = 41/42 (97%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTS+AT+ AA+GQCGVNC Sbjct: 1028 PTIVIVWSILLASIFSLLWVRIDPFTSDATKAAAKGQCGVNC 1069 >gb|EOY31461.1| Cellulose synthase 1 [Theobroma cacao] Length = 1085 Score = 82.0 bits (201), Expect = 7e-14 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTS+AT+ AA GQCG+NC Sbjct: 1044 PTIVIVWSILLASIFSLLWVRIDPFTSDATKSAANGQCGINC 1085 >gb|AGC97433.2| cellulose synthase [Boehmeria nivea] Length = 1082 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTS+AT+ A++GQCGVNC Sbjct: 1041 PTIVIVWSILLASIFSLLWVRIDPFTSDATKAASRGQCGVNC 1082 >gb|AAY78952.3| cellulose synthase CesA1 [Boehmeria nivea] Length = 938 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTS+AT+ A++GQCGVNC Sbjct: 897 PTIVIVWSILLASIFSLLWVRIDPFTSDATKAASRGQCGVNC 938 >gb|AFZ78556.1| cellulose synthase [Populus tomentosa] Length = 1075 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTS++T+ AA GQCG+NC Sbjct: 1034 PTIVIVWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC 1075 >ref|XP_002308657.1| cellulose synthase family protein [Populus trichocarpa] gi|224143917|ref|XP_002336091.1| predicted protein [Populus trichocarpa] gi|222854633|gb|EEE92180.1| cellulose synthase family protein [Populus trichocarpa] Length = 1075 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTS++T+ AA GQCG+NC Sbjct: 1034 PTIVIVWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC 1075 >gb|AAO25536.1| cellulose synthase [Populus tremuloides] Length = 1083 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTS++T+ AA GQCG+NC Sbjct: 1042 PTIVIVWSILLASIFSLLWVRIDPFTSDSTKAAANGQCGINC 1083 >gb|EMJ22782.1| hypothetical protein PRUPE_ppa000611mg [Prunus persica] Length = 1072 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFT++AT+ A+ GQCGVNC Sbjct: 1031 PTIVIVWSILLASIFSLLWVRIDPFTNDATKAASNGQCGVNC 1072 >ref|XP_002515536.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative [Ricinus communis] gi|223545480|gb|EEF46985.1| Cellulose synthase A catalytic subunit 6 [UDP-forming], putative [Ricinus communis] Length = 1083 Score = 80.1 bits (196), Expect = 3e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTS+A + AA GQCG+NC Sbjct: 1042 PTIVIVWSILLASIFSLLWVRIDPFTSDAAKAAANGQCGINC 1083 >ref|XP_006361724.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming] [Solanum tuberosum] Length = 1086 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/42 (80%), Positives = 41/42 (97%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVW++LLASIFSLLWVRIDPFTS+A++ AA+GQCG+NC Sbjct: 1045 PTIVIVWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC 1086 >ref|XP_004245031.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like [Solanum lycopersicum] Length = 1086 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/42 (80%), Positives = 41/42 (97%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVW++LLASIFSLLWVRIDPFTS+A++ AA+GQCG+NC Sbjct: 1045 PTIVIVWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC 1086 >gb|AAP97497.1| cellulose synthase [Solanum tuberosum] Length = 771 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/42 (80%), Positives = 41/42 (97%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVW++LLASIFSLLWVRIDPFTS+A++ AA+GQCG+NC Sbjct: 730 PTIVIVWAVLLASIFSLLWVRIDPFTSDASKTAARGQCGINC 771 >gb|AFZ78558.1| cellulose synthase [Populus tomentosa] Length = 1084 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTS T+ A GQCG+NC Sbjct: 1043 PTIVIVWSILLASIFSLLWVRIDPFTSSTTQTTANGQCGINC 1084 >ref|XP_002324291.1| TGACG-motif binding family protein [Populus trichocarpa] gi|222865725|gb|EEF02856.1| TGACG-motif binding family protein [Populus trichocarpa] Length = 1084 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTS T+ A+ GQCGVNC Sbjct: 1043 PTIVIVWSILLASIFSLLWVRIDPFTSGTTQTASNGQCGVNC 1084 >gb|EPS68064.1| hypothetical protein M569_06709, partial [Genlisea aurea] Length = 1088 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTS+ + AQGQCG++C Sbjct: 1047 PTIVIVWSILLASIFSLLWVRIDPFTSQTAKSTAQGQCGISC 1088 >gb|AEK31219.1| cellulose synthase A [Eucalyptus camaldulensis] Length = 1085 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVRIDPFTS T A GQCG+NC Sbjct: 1044 PTIVIVWSILLASIFSLLWVRIDPFTSATTTSTANGQCGINC 1085 >ref|XP_006483337.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like isoform X1 [Citrus sinensis] Length = 1102 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVR+DPFTS+ T+ + GQCG+NC Sbjct: 1061 PTIVIVWSILLASIFSLLWVRVDPFTSDDTKANSNGQCGINC 1102 >ref|XP_006450469.1| hypothetical protein CICLE_v10007296mg [Citrus clementina] gi|568859626|ref|XP_006483338.1| PREDICTED: cellulose synthase A catalytic subunit 1 [UDP-forming]-like isoform X2 [Citrus sinensis] gi|557553695|gb|ESR63709.1| hypothetical protein CICLE_v10007296mg [Citrus clementina] Length = 1085 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 2 PTIVIVWSILLASIFSLLWVRIDPFTSEATRRAAQGQCGVNC 127 PTIVIVWSILLASIFSLLWVR+DPFTS+ T+ + GQCG+NC Sbjct: 1044 PTIVIVWSILLASIFSLLWVRVDPFTSDDTKANSNGQCGINC 1085