BLASTX nr result
ID: Rehmannia26_contig00011858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00011858 (316 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006398341.1| hypothetical protein EUTSA_v10001136mg [Eutr... 59 9e-07 >ref|XP_006398341.1| hypothetical protein EUTSA_v10001136mg [Eutrema salsugineum] gi|557099430|gb|ESQ39794.1| hypothetical protein EUTSA_v10001136mg [Eutrema salsugineum] Length = 206 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/55 (45%), Positives = 36/55 (65%) Frame = -3 Query: 170 KNGQNAQYHRDLDAYNKWVDQDRSARYTMLRCMHDHLIREFEKYPTSKELWDGLK 6 + G AQ+ +D + Y W +DR AR T+L CM D L+ EFE+Y T+K +W+ LK Sbjct: 59 EQGTTAQHEKDQEVYVAWKRKDRIARITLLSCMQDDLMCEFEEYETAKGMWEALK 113