BLASTX nr result
ID: Rehmannia26_contig00011694
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00011694 (450 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA60677.1| gip1 [Petunia x hybrida] 83 4e-14 gb|AAG43509.1|AF210049_1 gibberellin-induced protein 1 [Petunia ... 83 4e-14 emb|CAD10104.1| gibberellin induced protein 3 [Petunia x hybrida] 83 4e-14 ref|XP_006446220.1| hypothetical protein CICLE_v10017244mg [Citr... 81 2e-13 ref|XP_006828424.1| hypothetical protein AMTR_s00060p00095260 [A... 81 2e-13 ref|XP_003629688.1| Gibberellin induced protein [Medicago trunca... 81 2e-13 gb|AGM20679.1| GASA5 [Populus tomentosa] 80 3e-13 gb|AAA98520.1| GASA5 [Arabidopsis thaliana] 80 3e-13 ref|NP_566186.1| gibberellin-regulated protein 5 [Arabidopsis th... 80 3e-13 ref|XP_002301709.1| predicted protein [Populus trichocarpa] 80 3e-13 ref|XP_002301708.1| predicted protein [Populus trichocarpa] gi|5... 80 3e-13 ref|XP_004140359.1| PREDICTED: protein RSI-1-like [Cucumis sativus] 80 4e-13 ref|XP_002530088.1| GAST1 protein precursor, putative [Ricinus c... 80 4e-13 ref|XP_006338319.1| PREDICTED: protein GAST1-like [Solanum tuber... 79 5e-13 ref|XP_002308912.2| hypothetical protein POPTR_0006s04300g [Popu... 79 5e-13 gb|AAC32170.1| GASA5-like protein [Picea mariana] gi|2996160|gb|... 79 5e-13 gb|AAG52379.1|AC011765_31 GAST1-like protein; 109761-110213 [Ara... 79 5e-13 ref|XP_004232126.1| PREDICTED: protein GAST1-like [Solanum lycop... 79 5e-13 emb|CBL95259.1| gasa5 like protein [Pinus pinaster] 79 5e-13 ref|XP_002887551.1| hypothetical protein ARALYDRAFT_895333 [Arab... 79 5e-13 >emb|CAA60677.1| gip1 [Petunia x hybrida] Length = 112 Score = 82.8 bits (203), Expect = 4e-14 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVPAGTYGNKQTCPCYNNWKT+EG PKCP Sbjct: 79 CAKCLCVPAGTYGNKQTCPCYNNWKTKEGGPKCP 112 >gb|AAG43509.1|AF210049_1 gibberellin-induced protein 1 [Petunia x hybrida] gi|16516819|emb|CAD10103.1| putative gibberellin induced protein 2 [Petunia x hybrida] Length = 112 Score = 82.8 bits (203), Expect = 4e-14 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVPAGTYGNKQTCPCYNNWKT+EG PKCP Sbjct: 79 CAKCLCVPAGTYGNKQTCPCYNNWKTKEGGPKCP 112 >emb|CAD10104.1| gibberellin induced protein 3 [Petunia x hybrida] Length = 112 Score = 82.8 bits (203), Expect = 4e-14 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVPAGTYGNKQTCPCYNNWKT+EG PKCP Sbjct: 79 CAKCLCVPAGTYGNKQTCPCYNNWKTKEGGPKCP 112 >ref|XP_006446220.1| hypothetical protein CICLE_v10017244mg [Citrus clementina] gi|557548831|gb|ESR59460.1| hypothetical protein CICLE_v10017244mg [Citrus clementina] Length = 113 Score = 80.9 bits (198), Expect = 2e-13 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVPAGTYGNKQTCPCYNNWKT+ G PKCP Sbjct: 80 CAKCLCVPAGTYGNKQTCPCYNNWKTKRGGPKCP 113 >ref|XP_006828424.1| hypothetical protein AMTR_s00060p00095260 [Amborella trichopoda] gi|548833172|gb|ERM95840.1| hypothetical protein AMTR_s00060p00095260 [Amborella trichopoda] Length = 91 Score = 80.9 bits (198), Expect = 2e-13 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CA CLCVP GTYGNKQ+CPCYNNWKTQEGRPKCP Sbjct: 58 CAVCLCVPPGTYGNKQSCPCYNNWKTQEGRPKCP 91 >ref|XP_003629688.1| Gibberellin induced protein [Medicago truncatula] gi|355523710|gb|AET04164.1| Gibberellin induced protein [Medicago truncatula] Length = 95 Score = 80.9 bits (198), Expect = 2e-13 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVP+GTYGNKQ CPCYNNWKT+EG+PKCP Sbjct: 62 CAKCLCVPSGTYGNKQECPCYNNWKTKEGKPKCP 95 >gb|AGM20679.1| GASA5 [Populus tomentosa] Length = 95 Score = 80.1 bits (196), Expect = 3e-13 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CA CLCVP GTYGNK+TCPCYNNWKT+EGRPKCP Sbjct: 62 CATCLCVPPGTYGNKETCPCYNNWKTKEGRPKCP 95 >gb|AAA98520.1| GASA5 [Arabidopsis thaliana] Length = 97 Score = 80.1 bits (196), Expect = 3e-13 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 C KCLCVP GT+GNKQTCPCYNNWKT+EGRPKCP Sbjct: 64 CKKCLCVPPGTFGNKQTCPCYNNWKTKEGRPKCP 97 >ref|NP_566186.1| gibberellin-regulated protein 5 [Arabidopsis thaliana] gi|75146611|sp|Q84J95.1|GASA5_ARATH RecName: Full=Gibberellin-regulated protein 5; AltName: Full=GAST1 protein homolog 5; Flags: Precursor gi|27754322|gb|AAO22614.1| unknown protein [Arabidopsis thaliana] gi|28393883|gb|AAO42349.1| unknown protein [Arabidopsis thaliana] gi|332640353|gb|AEE73874.1| gibberellin-regulated protein 5 [Arabidopsis thaliana] Length = 97 Score = 80.1 bits (196), Expect = 3e-13 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 C KCLCVP GT+GNKQTCPCYNNWKT+EGRPKCP Sbjct: 64 CKKCLCVPPGTFGNKQTCPCYNNWKTKEGRPKCP 97 >ref|XP_002301709.1| predicted protein [Populus trichocarpa] Length = 61 Score = 80.1 bits (196), Expect = 3e-13 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CA CLCVP GTYGNK+TCPCYNNWKT+EGRPKCP Sbjct: 28 CATCLCVPPGTYGNKETCPCYNNWKTKEGRPKCP 61 >ref|XP_002301708.1| predicted protein [Populus trichocarpa] gi|566171373|ref|XP_006383339.1| gibberellin-regulated protein 5 [Populus trichocarpa] gi|550338948|gb|ERP61136.1| gibberellin-regulated protein 5 [Populus trichocarpa] Length = 95 Score = 80.1 bits (196), Expect = 3e-13 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CA CLCVP GTYGNK+TCPCYNNWKT+EGRPKCP Sbjct: 62 CATCLCVPPGTYGNKETCPCYNNWKTKEGRPKCP 95 >ref|XP_004140359.1| PREDICTED: protein RSI-1-like [Cucumis sativus] Length = 122 Score = 79.7 bits (195), Expect = 4e-13 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVP+GTYGNKQ CPCYNNWKTQ+G PKCP Sbjct: 89 CAKCLCVPSGTYGNKQECPCYNNWKTQQGGPKCP 122 >ref|XP_002530088.1| GAST1 protein precursor, putative [Ricinus communis] gi|223530399|gb|EEF32287.1| GAST1 protein precursor, putative [Ricinus communis] Length = 116 Score = 79.7 bits (195), Expect = 4e-13 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVP+GTYGNKQTCPCYNNWKT+ G PKCP Sbjct: 83 CAKCLCVPSGTYGNKQTCPCYNNWKTKRGGPKCP 116 >ref|XP_006338319.1| PREDICTED: protein GAST1-like [Solanum tuberosum] Length = 112 Score = 79.3 bits (194), Expect = 5e-13 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVPAGTYGNKQ+CPCYNNWKT+ G PKCP Sbjct: 79 CAKCLCVPAGTYGNKQSCPCYNNWKTKRGGPKCP 112 >ref|XP_002308912.2| hypothetical protein POPTR_0006s04300g [Populus trichocarpa] gi|550335437|gb|EEE92435.2| hypothetical protein POPTR_0006s04300g [Populus trichocarpa] Length = 116 Score = 79.3 bits (194), Expect = 5e-13 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVPAGTYGNKQ+CPCYNNWKT+ G PKCP Sbjct: 83 CAKCLCVPAGTYGNKQSCPCYNNWKTKRGGPKCP 116 >gb|AAC32170.1| GASA5-like protein [Picea mariana] gi|2996160|gb|AAC32171.1| GASA5-like protein [Picea mariana] Length = 62 Score = 79.3 bits (194), Expect = 5e-13 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVP GTYGNKQ CPCYNNWKTQ+G PKCP Sbjct: 29 CAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP 62 >gb|AAG52379.1|AC011765_31 GAST1-like protein; 109761-110213 [Arabidopsis thaliana] Length = 80 Score = 79.3 bits (194), Expect = 5e-13 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVP GTYGNKQ CPCYNNWKTQ+G PKCP Sbjct: 47 CAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP 80 >ref|XP_004232126.1| PREDICTED: protein GAST1-like [Solanum lycopersicum] gi|121689|sp|P27057.1|GAST1_SOLLC RecName: Full=Protein GAST1; Flags: Precursor gi|19247|emb|CAA44807.1| gast1 [Solanum lycopersicum] Length = 112 Score = 79.3 bits (194), Expect = 5e-13 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVPAGTYGNKQ+CPCYNNWKT+ G PKCP Sbjct: 79 CAKCLCVPAGTYGNKQSCPCYNNWKTKRGGPKCP 112 >emb|CBL95259.1| gasa5 like protein [Pinus pinaster] Length = 108 Score = 79.3 bits (194), Expect = 5e-13 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVP GTYGNKQ CPCYNNWKTQ+G PKCP Sbjct: 75 CAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP 108 >ref|XP_002887551.1| hypothetical protein ARALYDRAFT_895333 [Arabidopsis lyrata subsp. lyrata] gi|297333392|gb|EFH63810.1| hypothetical protein ARALYDRAFT_895333 [Arabidopsis lyrata subsp. lyrata] Length = 101 Score = 79.3 bits (194), Expect = 5e-13 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 450 CAKCLCVPAGTYGNKQTCPCYNNWKTQEGRPKCP 349 CAKCLCVP GTYGNKQ CPCYNNWKTQ+G PKCP Sbjct: 68 CAKCLCVPPGTYGNKQVCPCYNNWKTQQGGPKCP 101