BLASTX nr result
ID: Rehmannia26_contig00010496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00010496 (364 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006339524.1| PREDICTED: digalactosyldiacylglycerol syntha... 61 2e-07 ref|XP_004229919.1| PREDICTED: digalactosyldiacylglycerol syntha... 61 2e-07 ref|XP_006341724.1| PREDICTED: digalactosyldiacylglycerol syntha... 60 3e-07 ref|XP_004248577.1| PREDICTED: digalactosyldiacylglycerol syntha... 58 1e-06 >ref|XP_006339524.1| PREDICTED: digalactosyldiacylglycerol synthase 2, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565344868|ref|XP_006339525.1| PREDICTED: digalactosyldiacylglycerol synthase 2, chloroplastic-like isoform X2 [Solanum tuberosum] gi|565344870|ref|XP_006339526.1| PREDICTED: digalactosyldiacylglycerol synthase 2, chloroplastic-like isoform X3 [Solanum tuberosum] Length = 462 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +2 Query: 2 ASALIHFVGTAFLTKQPDEEQCKEVGLSVPSKKQ-YPSRKW 121 ASAL+HFVGT FL+ QPDEEQCKE+GL VP K+ + S KW Sbjct: 421 ASALVHFVGTGFLSSQPDEEQCKELGLKVPPKRTGFSSGKW 461 >ref|XP_004229919.1| PREDICTED: digalactosyldiacylglycerol synthase 2, chloroplastic-like [Solanum lycopersicum] Length = 458 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +2 Query: 2 ASALIHFVGTAFLTKQPDEEQCKEVGLSVPSKKQ-YPSRKW 121 ASAL+HFVGT FL+ QPDEEQCKE+GL VP K+ + S KW Sbjct: 417 ASALVHFVGTGFLSSQPDEEQCKELGLKVPPKRTGFSSGKW 457 >ref|XP_006341724.1| PREDICTED: digalactosyldiacylglycerol synthase 2, chloroplastic-like [Solanum tuberosum] Length = 461 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/41 (63%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = +2 Query: 2 ASALIHFVGTAFLTKQPDEEQCKEVGLSVPSKKQ-YPSRKW 121 ASA +HF+GT FL+ QPDEEQCKE+GL++PSKK+ + S +W Sbjct: 420 ASASVHFMGTGFLSSQPDEEQCKELGLAIPSKKKGFSSGRW 460 >ref|XP_004248577.1| PREDICTED: digalactosyldiacylglycerol synthase 2, chloroplastic-like [Solanum lycopersicum] Length = 461 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +2 Query: 2 ASALIHFVGTAFLTKQPDEEQCKEVGLSVPSKK-QYPSRKW 121 ASA +HF+GT FL QPDEEQCKE+GL++PSKK + S +W Sbjct: 420 ASASVHFMGTGFLGSQPDEEQCKELGLAIPSKKIGFSSGRW 460