BLASTX nr result
ID: Rehmannia26_contig00008919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00008919 (333 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006576245.1| PREDICTED: uncharacterized protein LOC100809... 82 1e-13 ref|NP_001241928.1| uncharacterized protein LOC100809485 [Glycin... 82 1e-13 gb|EOY11500.1| ATP-dependent caseinolytic (Clp) protease/crotona... 81 1e-13 gb|ESW19017.1| hypothetical protein PHAVU_006G089800g [Phaseolus... 77 2e-12 gb|ESW19016.1| hypothetical protein PHAVU_006G089800g [Phaseolus... 77 2e-12 ref|XP_004144780.1| PREDICTED: ATP-dependent Clp protease proteo... 76 4e-12 ref|XP_003554645.1| PREDICTED: ATP-dependent Clp protease proteo... 75 7e-12 ref|XP_002512428.1| ATP-dependent Clp protease proteolytic subun... 74 3e-11 ref|XP_006417609.1| hypothetical protein EUTSA_v100081801mg, par... 72 8e-11 gb|EXC05639.1| ATP-dependent Clp protease proteolytic subunit-re... 72 1e-10 gb|EXB99256.1| ATP-dependent Clp protease proteolytic subunit-re... 72 1e-10 ref|XP_006304553.1| hypothetical protein CARUB_v10011543mg, part... 71 1e-10 ref|XP_006344669.1| PREDICTED: ATP-dependent Clp protease proteo... 71 2e-10 ref|XP_004230237.1| PREDICTED: ATP-dependent Clp protease proteo... 71 2e-10 ref|XP_004230236.1| PREDICTED: ATP-dependent Clp protease proteo... 71 2e-10 gb|AAB70396.1| Similar to ATP-dependent Clp protease (gb|D90915)... 71 2e-10 dbj|BAD43698.1| ClpP protease complex subunit ClpR3 [Arabidopsis... 71 2e-10 dbj|BAD44446.1| ClpP protease complex subunit ClpR3 [Arabidopsis... 71 2e-10 ref|NP_563836.1| ATP-dependent Clp protease proteolytic subunit-... 71 2e-10 ref|NP_001184945.1| ATP-dependent Clp protease proteolytic subun... 71 2e-10 >ref|XP_006576245.1| PREDICTED: uncharacterized protein LOC100809485 isoform X1 [Glycine max] Length = 324 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +3 Query: 201 AINSTKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 ++N+ KIPMPP+NPKDPFLS+LAS+AA+SPDTLLN PKNSDTPP Sbjct: 36 SVNAAKIPMPPLNPKDPFLSKLASIAASSPDTLLNTPKNSDTPP 79 >ref|NP_001241928.1| uncharacterized protein LOC100809485 [Glycine max] gi|255635968|gb|ACU18330.1| unknown [Glycine max] Length = 324 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +3 Query: 201 AINSTKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 ++N+ KIPMPP+NPKDPFLS+LAS+AA+SPDTLLN PKNSDTPP Sbjct: 36 SVNAAKIPMPPLNPKDPFLSKLASIAASSPDTLLNTPKNSDTPP 79 >gb|EOY11500.1| ATP-dependent caseinolytic (Clp) protease/crotonase family protein isoform 1 [Theobroma cacao] gi|508719604|gb|EOY11501.1| ATP-dependent caseinolytic (Clp) protease/crotonase family protein isoform 1 [Theobroma cacao] Length = 325 Score = 81.3 bits (199), Expect = 1e-13 Identities = 44/80 (55%), Positives = 49/80 (61%), Gaps = 6/80 (7%) Frame = +3 Query: 111 MANCLRMPMAXXXXXXXXXXXXXXXXXXX------GAINSTKIPMPPVNPKDPFLSRLAS 272 MA+CL PMA GA N+ KIPMPPVNPKDPFLS+LAS Sbjct: 1 MASCLHAPMAYRIPSSASSQSVRRPKALTLSCRAFGAKNAAKIPMPPVNPKDPFLSKLAS 60 Query: 273 VAATSPDTLLNRPKNSDTPP 332 VAA+SP+TLLNRP N DTPP Sbjct: 61 VAASSPETLLNRPVNPDTPP 80 >gb|ESW19017.1| hypothetical protein PHAVU_006G089800g [Phaseolus vulgaris] Length = 283 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = +3 Query: 201 AINSTKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 A N+ KIPMPP+NPKDPFLS+LASVAA+SP+T LN P+NSDTPP Sbjct: 41 ATNTAKIPMPPLNPKDPFLSKLASVAASSPETFLNPPRNSDTPP 84 >gb|ESW19016.1| hypothetical protein PHAVU_006G089800g [Phaseolus vulgaris] Length = 329 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = +3 Query: 201 AINSTKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 A N+ KIPMPP+NPKDPFLS+LASVAA+SP+T LN P+NSDTPP Sbjct: 41 ATNTAKIPMPPLNPKDPFLSKLASVAASSPETFLNPPRNSDTPP 84 >ref|XP_004144780.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic-like [Cucumis sativus] gi|449490882|ref|XP_004158737.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic-like [Cucumis sativus] Length = 331 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/78 (48%), Positives = 49/78 (62%), Gaps = 3/78 (3%) Frame = +3 Query: 108 PMANCLRMPMAXXXXXXXXXXXXXXXXXXXGAINST---KIPMPPVNPKDPFLSRLASVA 278 PM L+ PMA +N+T K+P+PP+NPKDPFLS+LASVA Sbjct: 8 PMTVTLQKPMAMAAPSSSFSLHRAINFRTVSCLNATSNAKVPLPPINPKDPFLSKLASVA 67 Query: 279 ATSPDTLLNRPKNSDTPP 332 +TSP+TLLNRP NS++PP Sbjct: 68 STSPETLLNRPANSESPP 85 >ref|XP_003554645.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic-like [Glycine max] Length = 327 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = +3 Query: 201 AINSTKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 ++N KIPMPP+NPKDPFLS+LASVAA+SP+TLLN PKNSDT P Sbjct: 39 SVNRPKIPMPPLNPKDPFLSKLASVAASSPETLLNTPKNSDTLP 82 >ref|XP_002512428.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] gi|223548389|gb|EEF49880.1| ATP-dependent Clp protease proteolytic subunit, putative [Ricinus communis] Length = 325 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = +3 Query: 207 NSTKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 +S+KIPMPP+NPKDPFLS+LAS+AA SPD+LL+RP SDTPP Sbjct: 39 SSSKIPMPPINPKDPFLSKLASIAANSPDSLLDRPITSDTPP 80 >ref|XP_006417609.1| hypothetical protein EUTSA_v100081801mg, partial [Eutrema salsugineum] gi|567153848|ref|XP_006417610.1| hypothetical protein EUTSA_v100081801mg, partial [Eutrema salsugineum] gi|557095380|gb|ESQ35962.1| hypothetical protein EUTSA_v100081801mg, partial [Eutrema salsugineum] gi|557095381|gb|ESQ35963.1| hypothetical protein EUTSA_v100081801mg, partial [Eutrema salsugineum] Length = 195 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 210 STKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 + KIPMPP+NPKDPFLS LASVAA SP+ LLNRP N+DTPP Sbjct: 44 AAKIPMPPINPKDPFLSTLASVAANSPEKLLNRPVNADTPP 84 >gb|EXC05639.1| ATP-dependent Clp protease proteolytic subunit-related protein 3 [Morus notabilis] Length = 329 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/39 (79%), Positives = 38/39 (97%) Frame = +3 Query: 216 KIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 KIP+PP+NPKDPFLS+LASVAATSP+TLL+RP NS++PP Sbjct: 46 KIPVPPINPKDPFLSKLASVAATSPETLLDRPVNSESPP 84 >gb|EXB99256.1| ATP-dependent Clp protease proteolytic subunit-related protein 3 [Morus notabilis] Length = 369 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/39 (79%), Positives = 38/39 (97%) Frame = +3 Query: 216 KIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 KIP+PP+NPKDPFLS+LASVAATSP+TLL+RP NS++PP Sbjct: 46 KIPVPPINPKDPFLSKLASVAATSPETLLDRPVNSESPP 84 >ref|XP_006304553.1| hypothetical protein CARUB_v10011543mg, partial [Capsella rubella] gi|482573264|gb|EOA37451.1| hypothetical protein CARUB_v10011543mg, partial [Capsella rubella] Length = 426 Score = 71.2 bits (173), Expect = 1e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 210 STKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 S +IPMPP+NPKDPFLS LASVAA SP+ LLNRP NSD PP Sbjct: 68 SARIPMPPINPKDPFLSTLASVAANSPEKLLNRPVNSDVPP 108 >ref|XP_006344669.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic-like [Solanum tuberosum] Length = 326 Score = 70.9 bits (172), Expect = 2e-10 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 5/79 (6%) Frame = +3 Query: 111 MANCLRMPMAXXXXXXXXXXXXXXXXXXX-----GAINSTKIPMPPVNPKDPFLSRLASV 275 MA CLR+PMA + +S+ IPMPP NPKDPFLS+LASV Sbjct: 1 MATCLRLPMASSIPCSSSSSMTLKHRSFNIRCAAYSNSSSNIPMPPFNPKDPFLSKLASV 60 Query: 276 AATSPDTLLNRPKNSDTPP 332 AA +PD L +RP+NSD PP Sbjct: 61 AANNPDALFSRPQNSDMPP 79 >ref|XP_004230237.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic-like isoform 2 [Solanum lycopersicum] Length = 326 Score = 70.9 bits (172), Expect = 2e-10 Identities = 38/79 (48%), Positives = 45/79 (56%), Gaps = 5/79 (6%) Frame = +3 Query: 111 MANCLRMPMAXXXXXXXXXXXXXXXXXXXGAI-----NSTKIPMPPVNPKDPFLSRLASV 275 MA CLR+PMA +S+ IPMPP NPKDPFLS+LASV Sbjct: 1 MATCLRLPMASSIPCSSSSSMTLKHRSFNFRCAAYSNSSSNIPMPPFNPKDPFLSKLASV 60 Query: 276 AATSPDTLLNRPKNSDTPP 332 AA +PD L +RP+NSD PP Sbjct: 61 AANNPDALFSRPQNSDMPP 79 >ref|XP_004230236.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic-like isoform 1 [Solanum lycopersicum] Length = 347 Score = 70.9 bits (172), Expect = 2e-10 Identities = 38/79 (48%), Positives = 45/79 (56%), Gaps = 5/79 (6%) Frame = +3 Query: 111 MANCLRMPMAXXXXXXXXXXXXXXXXXXXGAI-----NSTKIPMPPVNPKDPFLSRLASV 275 MA CLR+PMA +S+ IPMPP NPKDPFLS+LASV Sbjct: 1 MATCLRLPMASSIPCSSSSSMTLKHRSFNFRCAAYSNSSSNIPMPPFNPKDPFLSKLASV 60 Query: 276 AATSPDTLLNRPKNSDTPP 332 AA +PD L +RP+NSD PP Sbjct: 61 AANNPDALFSRPQNSDMPP 79 >gb|AAB70396.1| Similar to ATP-dependent Clp protease (gb|D90915). EST gb|N65461 comes from this gene [Arabidopsis thaliana] Length = 292 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 210 STKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 S KIPMPP+NPKDPFLS LAS+AA SP+ LLNRP N+D PP Sbjct: 47 SAKIPMPPINPKDPFLSTLASIAANSPEKLLNRPVNADVPP 87 >dbj|BAD43698.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] Length = 315 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 210 STKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 S KIPMPP+NPKDPFLS LAS+AA SP+ LLNRP N+D PP Sbjct: 32 SAKIPMPPINPKDPFLSTLASIAANSPEKLLNRPVNADVPP 72 >dbj|BAD44446.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] Length = 330 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 210 STKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 S KIPMPP+NPKDPFLS LAS+AA SP+ LLNRP N+D PP Sbjct: 47 SAKIPMPPINPKDPFLSTLASIAANSPEKLLNRPVNADVPP 87 >ref|NP_563836.1| ATP-dependent Clp protease proteolytic subunit-related protein 3 [Arabidopsis thaliana] gi|79317437|ref|NP_001031008.1| ATP-dependent Clp protease proteolytic subunit-related protein 3 [Arabidopsis thaliana] gi|75301131|sp|Q8L770.1|CLPR3_ARATH RecName: Full=ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic; Short=ClpR3; AltName: Full=nClpP8; Flags: Precursor gi|22531207|gb|AAM97107.1| ATP-dependent Clp protease proteolytic subunit (ClpR3), putative [Arabidopsis thaliana] gi|25083963|gb|AAN72143.1| ATP-dependent Clp protease proteolytic subunit (ClpR3), putative [Arabidopsis thaliana] gi|51968388|dbj|BAD42886.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] gi|51968776|dbj|BAD43080.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] gi|51968816|dbj|BAD43100.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] gi|51969676|dbj|BAD43530.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] gi|51969856|dbj|BAD43620.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] gi|51969858|dbj|BAD43621.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] gi|51971032|dbj|BAD44208.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] gi|51971379|dbj|BAD44354.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] gi|51971381|dbj|BAD44355.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] gi|51971625|dbj|BAD44477.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] gi|51971739|dbj|BAD44534.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] gi|110742786|dbj|BAE99296.1| ClpP protease complex subunit ClpR3 [Arabidopsis thaliana] gi|332190276|gb|AEE28397.1| ATP-dependent Clp protease proteolytic subunit-related protein 3 [Arabidopsis thaliana] gi|332190277|gb|AEE28398.1| ATP-dependent Clp protease proteolytic subunit-related protein 3 [Arabidopsis thaliana] Length = 330 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 210 STKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 S KIPMPP+NPKDPFLS LAS+AA SP+ LLNRP N+D PP Sbjct: 47 SAKIPMPPINPKDPFLSTLASIAANSPEKLLNRPVNADVPP 87 >ref|NP_001184945.1| ATP-dependent Clp protease proteolytic subunit-related protein 3 [Arabidopsis thaliana] gi|332190278|gb|AEE28399.1| ATP-dependent Clp protease proteolytic subunit-related protein 3 [Arabidopsis thaliana] Length = 370 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 210 STKIPMPPVNPKDPFLSRLASVAATSPDTLLNRPKNSDTPP 332 S KIPMPP+NPKDPFLS LAS+AA SP+ LLNRP N+D PP Sbjct: 47 SAKIPMPPINPKDPFLSTLASIAANSPEKLLNRPVNADVPP 87