BLASTX nr result
ID: Rehmannia26_contig00007962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00007962 (340 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004307015.1| PREDICTED: acyl-CoA-binding domain-containin... 61 2e-07 gb|EMJ21862.1| hypothetical protein PRUPE_ppa004462mg [Prunus pe... 57 3e-06 gb|EXB39449.1| Acyl-CoA-binding domain-containing protein 4 [Mor... 55 7e-06 >ref|XP_004307015.1| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Fragaria vesca subsp. vesca] Length = 516 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +3 Query: 3 SLEGEVQALRSEKSAFERDMELAATTVERQRSGGIWKWVAG 125 S+E EVQALR +KSA ERDMEL A++V+RQ SGG+W+W+AG Sbjct: 472 SIEDEVQALRGQKSAMERDMEL-ASSVQRQGSGGVWRWIAG 511 >gb|EMJ21862.1| hypothetical protein PRUPE_ppa004462mg [Prunus persica] Length = 508 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = +3 Query: 3 SLEGEVQALRSEKSAFERDMELAATTVERQRSGGIWKWVAG 125 S+E EVQALR +KSA E+DMELA++ +RQ SGG+W+W+AG Sbjct: 463 SIEDEVQALRGQKSALEQDMELASSG-QRQGSGGVWRWIAG 502 >gb|EXB39449.1| Acyl-CoA-binding domain-containing protein 4 [Morus notabilis] Length = 511 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +3 Query: 3 SLEGEVQALRSEKSAFERDMELAATTVERQRSGGIWKWVAG 125 ++E EVQ LR +KSAFERD+EL A+ ++Q SGG+W+W+AG Sbjct: 469 AIEDEVQVLRRQKSAFERDIEL-ASAAQKQGSGGVWRWIAG 508