BLASTX nr result
ID: Rehmannia26_contig00007562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00007562 (565 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ23233.1| hypothetical protein PRUPE_ppa003040mg [Prunus pe... 66 7e-09 ref|XP_004292965.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >gb|EMJ23233.1| hypothetical protein PRUPE_ppa003040mg [Prunus persica] Length = 609 Score = 65.9 bits (159), Expect = 7e-09 Identities = 33/61 (54%), Positives = 47/61 (77%) Frame = +2 Query: 5 RLRTSSYERKISIIKRAESMSDVLKACKNPRVLVKHGFRPENDVVSAQKLMEDIKRKADL 184 R R +S+ R+ SII++AE+MSD+LK C +PR LVK+ PEN V A +L+EDIKRKA++ Sbjct: 549 RERDASHARRKSIIQKAEAMSDLLKTCSDPRELVKYRSLPENVVSRANQLVEDIKRKANI 608 Query: 185 R 187 + Sbjct: 609 Q 609 >ref|XP_004292965.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 582 Score = 63.9 bits (154), Expect = 3e-08 Identities = 32/59 (54%), Positives = 43/59 (72%) Frame = +2 Query: 11 RTSSYERKISIIKRAESMSDVLKACKNPRVLVKHGFRPENDVVSAQKLMEDIKRKADLR 187 R S+ER+ SIIK+AE+MS VLK C +PR LVKH PE+ A +L+EDIK KA+++ Sbjct: 524 RDESHERRKSIIKKAEAMSKVLKTCSDPRELVKHRSSPESVESRANRLIEDIKTKANIK 582 >ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Vitis vinifera] gi|296081989|emb|CBI20994.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 60.5 bits (145), Expect = 3e-07 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = +2 Query: 17 SSYERKISIIKRAESMSDVLKACKNPRVLVKHGFRPENDVVSAQKLMEDIKRKAD 181 +S RK SII+RAE+MSD+LK C +PR LVK EN V+ A +L+EDIKR+A+ Sbjct: 541 ASRARKTSIIQRAEAMSDILKTCNDPRELVKRRSSFENTVLVADQLIEDIKRRAN 595 >ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cucumis sativus] gi|449503560|ref|XP_004162063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cucumis sativus] Length = 615 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/51 (52%), Positives = 40/51 (78%) Frame = +2 Query: 29 RKISIIKRAESMSDVLKACKNPRVLVKHGFRPENDVVSAQKLMEDIKRKAD 181 R+ SI+++AE+MS++LK CK+PR LVK E+ V SA KL++DIK+KA+ Sbjct: 561 RRTSIMRKAEAMSEMLKVCKDPRELVKRRSPSEDAVFSANKLIDDIKKKAN 611