BLASTX nr result
ID: Rehmannia26_contig00005925
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00005925 (334 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71743.1| hypothetical protein M569_03018, partial [Genlise... 68 1e-09 gb|EOX93904.1| Small ubiquitin-like modifier 1, 1,SUMO1,ATSUMO1 ... 65 1e-08 gb|EXB56113.1| Small ubiquitin-related modifier 2 [Morus notabilis] 63 4e-08 ref|XP_006443587.1| hypothetical protein CICLE_v10022993mg [Citr... 63 4e-08 emb|CAA67923.1| ubiquitin-like protein [Arabidopsis thaliana] 63 5e-08 ref|XP_006284825.1| hypothetical protein CARUB_v10006104mg [Caps... 63 5e-08 ref|NP_194414.1| small ubiquitin-related modifier 1 [Arabidopsis... 63 5e-08 ref|XP_002869590.1| hypothetical protein ARALYDRAFT_492116 [Arab... 63 5e-08 gb|AGA37251.1| small ubiquitin-like modifier 1.1 [Brassica napus] 62 6e-08 gb|EMJ13486.1| hypothetical protein PRUPE_ppa013880mg [Prunus pe... 62 1e-07 ref|XP_004149348.1| PREDICTED: small ubiquitin-related modifier ... 62 1e-07 ref|XP_002262911.1| PREDICTED: small ubiquitin-related modifier ... 62 1e-07 emb|CAN79327.1| hypothetical protein VITISV_032072 [Vitis vinifera] 62 1e-07 ref|XP_006413134.1| hypothetical protein EUTSA_v10026654mg [Eutr... 61 1e-07 gb|AFW84166.1| hypothetical protein ZEAMMB73_953374 [Zea mays] g... 61 1e-07 gb|ACL50298.1| SUMO1b protein [Zea mays] 61 1e-07 gb|ACG34085.1| hypothetical protein [Zea mays] 61 1e-07 gb|ACG33621.1| ubiquitin-like protein SMT3 [Zea mays] 61 1e-07 ref|NP_001148325.1| ubiquitin-like protein SMT3 [Zea mays] gi|22... 61 1e-07 ref|XP_002274949.1| PREDICTED: uncharacterized protein LOC100267... 61 1e-07 >gb|EPS71743.1| hypothetical protein M569_03018, partial [Genlisea aurea] Length = 92 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 232 MSGQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 MSGQEEDKKPAD SAHINLKVKGQ+GNEVFFRIK Sbjct: 1 MSGQEEDKKPADTSAHINLKVKGQDGNEVFFRIK 34 >gb|EOX93904.1| Small ubiquitin-like modifier 1, 1,SUMO1,ATSUMO1 [Theobroma cacao] Length = 109 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 238 GQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 GQEEDKKPAD SAHINLKVKGQ+GNEVFFRIK Sbjct: 13 GQEEDKKPADQSAHINLKVKGQDGNEVFFRIK 44 >gb|EXB56113.1| Small ubiquitin-related modifier 2 [Morus notabilis] Length = 101 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 238 GQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 GQEEDKKP D SAHINLKVKGQ+GNEVFFRIK Sbjct: 10 GQEEDKKPVDQSAHINLKVKGQDGNEVFFRIK 41 >ref|XP_006443587.1| hypothetical protein CICLE_v10022993mg [Citrus clementina] gi|568851165|ref|XP_006479264.1| PREDICTED: small ubiquitin-related modifier 1-like [Citrus sinensis] gi|557545849|gb|ESR56827.1| hypothetical protein CICLE_v10022993mg [Citrus clementina] Length = 105 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 238 GQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 GQEEDKKP D SAHINLKVKGQ+GNEVFFRIK Sbjct: 11 GQEEDKKPVDQSAHINLKVKGQDGNEVFFRIK 42 >emb|CAA67923.1| ubiquitin-like protein [Arabidopsis thaliana] Length = 104 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 235 SGQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 + QEEDKKP DG AHINLKVKGQ+GNEVFFRIK Sbjct: 3 ANQEEDKKPGDGGAHINLKVKGQDGNEVFFRIK 35 >ref|XP_006284825.1| hypothetical protein CARUB_v10006104mg [Capsella rubella] gi|482553530|gb|EOA17723.1| hypothetical protein CARUB_v10006104mg [Capsella rubella] Length = 102 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 235 SGQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 + QEEDKKP DG AHINLKVKGQ+GNEVFFRIK Sbjct: 3 ANQEEDKKPGDGGAHINLKVKGQDGNEVFFRIK 35 >ref|NP_194414.1| small ubiquitin-related modifier 1 [Arabidopsis thaliana] gi|21542462|sp|P55852.2|SUMO1_ARATH RecName: Full=Small ubiquitin-related modifier 1; Short=AtSUMO1; AltName: Full=Ubiquitin-like protein SMT3 gi|4455207|emb|CAB36530.1| ubiquitin-like protein [Arabidopsis thaliana] gi|7269536|emb|CAB79539.1| ubiquitin-like protein [Arabidopsis thaliana] gi|18252867|gb|AAL62360.1| ubiquitin-like protein [Arabidopsis thaliana] gi|21592529|gb|AAM64478.1| ubiquitin-like protein [Arabidopsis thaliana] gi|22652842|gb|AAN03845.1| small ubiquitin-like modifier 1 [Arabidopsis thaliana] gi|30725548|gb|AAP37796.1| At4g26840 [Arabidopsis thaliana] gi|332659859|gb|AEE85259.1| small ubiquitin-related modifier 1 [Arabidopsis thaliana] Length = 100 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 235 SGQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 + QEEDKKP DG AHINLKVKGQ+GNEVFFRIK Sbjct: 3 ANQEEDKKPGDGGAHINLKVKGQDGNEVFFRIK 35 >ref|XP_002869590.1| hypothetical protein ARALYDRAFT_492116 [Arabidopsis lyrata subsp. lyrata] gi|297315426|gb|EFH45849.1| hypothetical protein ARALYDRAFT_492116 [Arabidopsis lyrata subsp. lyrata] Length = 92 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 235 SGQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 + QEEDKKP DG AHINLKVKGQ+GNEVFFRIK Sbjct: 3 ANQEEDKKPGDGGAHINLKVKGQDGNEVFFRIK 35 >gb|AGA37251.1| small ubiquitin-like modifier 1.1 [Brassica napus] Length = 98 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 241 QEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 QEEDKKP DG AHINLKVKGQ+GNEVFFRIK Sbjct: 5 QEEDKKPGDGGAHINLKVKGQDGNEVFFRIK 35 >gb|EMJ13486.1| hypothetical protein PRUPE_ppa013880mg [Prunus persica] Length = 98 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 232 MSGQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 ++ QEEDKKP D SAHINLKVKGQ+GNEVFFRIK Sbjct: 4 VTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIK 37 >ref|XP_004149348.1| PREDICTED: small ubiquitin-related modifier 2-like [Cucumis sativus] gi|449503205|ref|XP_004161886.1| PREDICTED: small ubiquitin-related modifier 2-like [Cucumis sativus] Length = 100 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 232 MSGQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 ++ QEEDKKP D SAHINLKVKGQ+GNEVFFRIK Sbjct: 4 VTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIK 37 >ref|XP_002262911.1| PREDICTED: small ubiquitin-related modifier 2 [Vitis vinifera] gi|296090483|emb|CBI40814.3| unnamed protein product [Vitis vinifera] Length = 103 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 238 GQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 GQEEDKKP D AHINLKVKGQ+GNEVFFRIK Sbjct: 10 GQEEDKKPTDQGAHINLKVKGQDGNEVFFRIK 41 >emb|CAN79327.1| hypothetical protein VITISV_032072 [Vitis vinifera] Length = 104 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 238 GQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 GQEEDKKP D AHINLKVKGQ+GNEVFFRIK Sbjct: 10 GQEEDKKPTDQGAHINLKVKGQDGNEVFFRIK 41 >ref|XP_006413134.1| hypothetical protein EUTSA_v10026654mg [Eutrema salsugineum] gi|557114304|gb|ESQ54587.1| hypothetical protein EUTSA_v10026654mg [Eutrema salsugineum] Length = 101 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 241 QEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 Q+EDKKP DG AHINLKVKGQ+GNEVFFRIK Sbjct: 5 QDEDKKPGDGGAHINLKVKGQDGNEVFFRIK 35 >gb|AFW84166.1| hypothetical protein ZEAMMB73_953374 [Zea mays] gi|413951525|gb|AFW84174.1| hypothetical protein ZEAMMB73_881709 [Zea mays] Length = 85 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/35 (85%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = +1 Query: 232 MSGQ-EEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 MSG EEDKKPA+G AHINLKVKGQ+GNEVFFRIK Sbjct: 1 MSGAGEEDKKPAEGGAHINLKVKGQDGNEVFFRIK 35 >gb|ACL50298.1| SUMO1b protein [Zea mays] Length = 109 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/35 (85%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = +1 Query: 232 MSGQ-EEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 MSG EEDKKPA+G AHINLKVKGQ+GNEVFFRIK Sbjct: 1 MSGAGEEDKKPAEGGAHINLKVKGQDGNEVFFRIK 35 >gb|ACG34085.1| hypothetical protein [Zea mays] Length = 62 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/35 (85%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = +1 Query: 232 MSGQ-EEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 MSG EEDKKPA+G AHINLKVKGQ+GNEVFFRIK Sbjct: 1 MSGAGEEDKKPAEGGAHINLKVKGQDGNEVFFRIK 35 >gb|ACG33621.1| ubiquitin-like protein SMT3 [Zea mays] Length = 130 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/35 (85%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = +1 Query: 232 MSGQ-EEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 MSG EEDKKPA+G AHINLKVKGQ+GNEVFFRIK Sbjct: 1 MSGAGEEDKKPAEGGAHINLKVKGQDGNEVFFRIK 35 >ref|NP_001148325.1| ubiquitin-like protein SMT3 [Zea mays] gi|226531103|ref|NP_001148344.1| LOC100281954 [Zea mays] gi|194699076|gb|ACF83622.1| unknown [Zea mays] gi|195605220|gb|ACG24440.1| ubiquitin-like protein SMT3 [Zea mays] gi|195609772|gb|ACG26716.1| ubiquitin-like protein SMT3 [Zea mays] gi|195610072|gb|ACG26866.1| ubiquitin-like protein SMT3 [Zea mays] gi|195617696|gb|ACG30678.1| ubiquitin-like protein SMT3 [Zea mays] gi|195618150|gb|ACG30905.1| ubiquitin-like protein SMT3 [Zea mays] gi|195618448|gb|ACG31054.1| ubiquitin-like protein SMT3 [Zea mays] gi|219870184|gb|ACL50297.1| SUMO1a protein [Zea mays] gi|413951516|gb|AFW84165.1| ubiquitin-like protein SMT3 [Zea mays] gi|413951524|gb|AFW84173.1| ubiquitin-like protein SMT3 [Zea mays] Length = 99 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/35 (85%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = +1 Query: 232 MSGQ-EEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 MSG EEDKKPA+G AHINLKVKGQ+GNEVFFRIK Sbjct: 1 MSGAGEEDKKPAEGGAHINLKVKGQDGNEVFFRIK 35 >ref|XP_002274949.1| PREDICTED: uncharacterized protein LOC100267064 [Vitis vinifera] gi|297739210|emb|CBI28861.3| unnamed protein product [Vitis vinifera] Length = 101 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +1 Query: 217 SACENMSGQEEDKKPADGSAHINLKVKGQEGNEVFFRIK 333 S N S Q+EDKKP D S HINLKVKGQ+GNEVFFRIK Sbjct: 2 SGVANPSSQDEDKKPNDQSGHINLKVKGQDGNEVFFRIK 40