BLASTX nr result
ID: Rehmannia26_contig00000830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00000830 (604 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315645.1| Photosystem II core complex proteins psbY [P... 56 7e-06 >ref|XP_002315645.1| Photosystem II core complex proteins psbY [Populus trichocarpa] gi|118489255|gb|ABK96433.1| unknown [Populus trichocarpa x Populus deltoides] gi|222864685|gb|EEF01816.1| Photosystem II core complex proteins psbY [Populus trichocarpa] Length = 196 Score = 56.2 bits (134), Expect = 7e-06 Identities = 30/54 (55%), Positives = 36/54 (66%), Gaps = 4/54 (7%) Frame = +2 Query: 455 ILNPKCFNSTNTKNIKPTKQ----FPLLSIQNLPKGLTGAAPQNNAAVTGTAIA 604 ILN KC + + KNI PTK LLS+QNLPKGLT + P +N +TGTAIA Sbjct: 10 ILNAKCLSINSNKNISPTKPSTKPVSLLSMQNLPKGLTISKPADNTVLTGTAIA 63