BLASTX nr result
ID: Rehmannia26_contig00000615
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia26_contig00000615 (441 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHC94919.1| early responsive to dehydration protein 15 [Ipomo... 59 9e-07 >gb|AHC94919.1| early responsive to dehydration protein 15 [Ipomoea batatas] Length = 167 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/55 (58%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +1 Query: 19 GVMGNGFGKNPNALVKSLSMPKQ-SPKSPREPIYWEKPAKHVGPKYSPRFIQQPR 180 G+ +G K P+ALVKSLS+PK+ PKS P Y+EKPAK V P+ S R IQQPR Sbjct: 113 GMSESGSAKRPDALVKSLSLPKERGPKSLVPPRYYEKPAKVVSPRCSLRRIQQPR 167