BLASTX nr result
ID: Rehmannia25_contig00029816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia25_contig00029816 (352 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240 ... 69 5e-10 >ref|XP_002489092.1| hypothetical protein SORBIDRAFT_0088s002240 [Sorghum bicolor] gi|241947412|gb|EES20557.1| hypothetical protein SORBIDRAFT_0088s002240 [Sorghum bicolor] Length = 58 Score = 69.3 bits (168), Expect = 5e-10 Identities = 34/44 (77%), Positives = 36/44 (81%), Gaps = 3/44 (6%) Frame = -2 Query: 348 LLTEPYVDVTAHTAPSQQAVSLPLQGMEVWMNRHQI---EEFFF 226 LLTEPYVDVTAHTAPSQQAVS PL+ MEVW+NRHQ FFF Sbjct: 10 LLTEPYVDVTAHTAPSQQAVSFPLEVMEVWINRHQTLVDRRFFF 53