BLASTX nr result
ID: Rehmannia24_contig00029479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00029479 (544 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527312.1| pentatricopeptide repeat-containing protein,... 57 4e-06 ref|XP_002299265.2| pentatricopeptide repeat-containing family p... 56 6e-06 >ref|XP_002527312.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533312|gb|EEF35064.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 802 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/63 (41%), Positives = 44/63 (69%) Frame = -3 Query: 506 LKQIQENIVNTLHMGQRTRASYLLPKLNFGDQALRVWNFISILQFWARTLDSVFAMEIWK 327 +K IQ+ I++ L++G+R RAS +L L + LR +F+ IL++ AR+ D +FAME W+ Sbjct: 57 VKSIQKQILDALNLGERGRASNMLSDLGHANNLLRPNDFVDILRYCARSPDPLFAMETWR 116 Query: 326 VMK 318 +M+ Sbjct: 117 IME 119 >ref|XP_002299265.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550347275|gb|EEE84070.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 733 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/72 (38%), Positives = 45/72 (62%) Frame = -3 Query: 497 IQENIVNTLHMGQRTRASYLLPKLNFGDQALRVWNFISILQFWARTLDSVFAMEIWKVMK 318 I + IV+ LHMG+R+RAS LL +L +L+ NF+ ILQ+ AR+ D + +E W++M+ Sbjct: 19 ILKQIVSALHMGKRSRASALLLELGQEKMSLKPHNFVPILQYCARSPDPLLVLETWQIME 78 Query: 317 NNSRWSDTSYFL 282 D+ +L Sbjct: 79 EKEVGLDSKCYL 90