BLASTX nr result
ID: Rehmannia24_contig00028872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00028872 (367 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437821.1| hypothetical protein CICLE_v10033630mg, part... 56 6e-06 >ref|XP_006437821.1| hypothetical protein CICLE_v10033630mg, partial [Citrus clementina] gi|557540017|gb|ESR51061.1| hypothetical protein CICLE_v10033630mg, partial [Citrus clementina] Length = 98 Score = 55.8 bits (133), Expect = 6e-06 Identities = 34/73 (46%), Positives = 47/73 (64%) Frame = +2 Query: 131 RVDGNDFVPFVFFKNKPAAFFHAFLIAMCFAFTGAVTTMSLRAKNRKTMASYCRRLAVVS 310 ++DGN VP V FKN+P FHAF++A+ F+F G+V T+SLR K + +A Y LA VS Sbjct: 21 KIDGNP-VPTVIFKNRPG-LFHAFILALNFSFFGSVLTISLRGKYAR-IARYPLILAAVS 77 Query: 311 VVIAAGVLLYSVL 349 A VL + V+ Sbjct: 78 TAAAIAVLTWLVV 90