BLASTX nr result
ID: Rehmannia24_contig00028829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00028829 (347 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY06204.1| Auxin-responsive protein IAA13, putative isoform ... 60 2e-07 gb|EOY06203.1| Auxin-responsive protein IAA13, putative isoform ... 60 2e-07 >gb|EOY06204.1| Auxin-responsive protein IAA13, putative isoform 2 [Theobroma cacao] Length = 308 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -2 Query: 280 RMFLSSVRRLRIRRTSEANGLAPRSHERNGRQLNTPI 170 RMFLSSVRRLRI RTSEANGLAPR H+RN RQ + PI Sbjct: 272 RMFLSSVRRLRIMRTSEANGLAPRFHDRNERQRSKPI 308 >gb|EOY06203.1| Auxin-responsive protein IAA13, putative isoform 1 [Theobroma cacao] Length = 307 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -2 Query: 280 RMFLSSVRRLRIRRTSEANGLAPRSHERNGRQLNTPI 170 RMFLSSVRRLRI RTSEANGLAPR H+RN RQ + PI Sbjct: 271 RMFLSSVRRLRIMRTSEANGLAPRFHDRNERQRSKPI 307