BLASTX nr result
ID: Rehmannia24_contig00028785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00028785 (364 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61426.1| hypothetical protein M569_13372 [Genlisea aurea] 56 6e-06 >gb|EPS61426.1| hypothetical protein M569_13372 [Genlisea aurea] Length = 389 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/85 (34%), Positives = 52/85 (61%), Gaps = 2/85 (2%) Frame = +1 Query: 115 DISSLCANLTLSEDEKIQI--PADLILTSEINTSLSLVGRVLAPRVINFDSISSMFKRLW 288 D+ + +++L+E+E + + P + T+E +T L LVG++L PR +N ++++ R + Sbjct: 4 DLLARFTSISLAEEESLPVVFPNGMGATNEADTGLYLVGKILHPRPVNPETVAKQMHRAF 63 Query: 289 SPKHGLNCKPLGDNTVLFQFSNLVD 363 +P L K LGDN LF+F +L D Sbjct: 64 NPLKELTVKFLGDNKFLFRFEHLGD 88