BLASTX nr result
ID: Rehmannia24_contig00028749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00028749 (427 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589895.1| TNP1 [Medicago truncatula] gi|355478943|gb|A... 68 1e-09 ref|XP_003620592.1| hypothetical protein MTR_6g087310 [Medicago ... 67 3e-09 ref|XP_003589878.1| Ubiquitin-like-specific protease [Medicago t... 67 3e-09 ref|XP_003613613.1| hypothetical protein MTR_5g038680 [Medicago ... 66 5e-09 ref|XP_004514733.1| PREDICTED: uncharacterized protein LOC101503... 58 1e-06 emb|CAN79827.1| hypothetical protein VITISV_006525 [Vitis vinifera] 57 3e-06 emb|CAN79821.1| hypothetical protein VITISV_020029 [Vitis vinifera] 56 6e-06 >ref|XP_003589895.1| TNP1 [Medicago truncatula] gi|355478943|gb|AES60146.1| TNP1 [Medicago truncatula] Length = 316 Score = 67.8 bits (164), Expect = 1e-09 Identities = 36/88 (40%), Positives = 54/88 (61%), Gaps = 1/88 (1%) Frame = -2 Query: 381 RYLYENFMVQNQSSRRFFFLSPHETGFVLKKQEQQKSLVDLLVQNGAKDKLVLAPYNISV 202 R+LYEN + +F FLSPH + ++ +Q + +VD+L+ + K+KL+ AP N+ + Sbjct: 231 RFLYENLIKPRGLVNKFSFLSPH----ISQEDKQGQQIVDILLTHKFKNKLIFAPVNLGL 286 Query: 201 -HWVLLAINVKAETIYYLDSMHGDPVNH 121 HWVLL IN E IYY+DS+ P H Sbjct: 287 NHWVLLVINPGVEMIYYMDSL---PAGH 311 >ref|XP_003620592.1| hypothetical protein MTR_6g087310 [Medicago truncatula] gi|355495607|gb|AES76810.1| hypothetical protein MTR_6g087310 [Medicago truncatula] Length = 185 Score = 66.6 bits (161), Expect = 3e-09 Identities = 36/96 (37%), Positives = 59/96 (61%), Gaps = 1/96 (1%) Frame = -2 Query: 384 LRYLYENFMVQNQSSRRFFFLSPHETGFVLKKQEQQKSLVDLLVQNGAKDKLVLAPYNIS 205 +R+LYEN + +F FLS H + ++ +Q + + D+L+ + K+KL+ AP N+ Sbjct: 59 VRFLYENLIKPRGLENKFSFLSRH----IYQEDKQGQQIADILLTHKFKNKLIFAPVNLG 114 Query: 204 V-HWVLLAINVKAETIYYLDSMHGDPVNHRDMVDIF 100 + HWVLL IN AE IYY+DS+ P H + +D++ Sbjct: 115 LNHWVLLVINPGAEMIYYMDSL---PAGHPN-IDVY 146 >ref|XP_003589878.1| Ubiquitin-like-specific protease [Medicago truncatula] gi|355478926|gb|AES60129.1| Ubiquitin-like-specific protease [Medicago truncatula] Length = 420 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/80 (42%), Positives = 51/80 (63%), Gaps = 1/80 (1%) Frame = -2 Query: 381 RYLYENFMVQNQSSRRFFFLSPHETGFVLKKQEQQKSLVDLLVQNGAKDKLVLAPYNISV 202 R+LYEN + +F FLSPH + ++ +Q + +VD+L+ + K+KL+ AP N+ + Sbjct: 247 RFLYENLIKPRGLVNKFSFLSPH----ISQEDKQGQQIVDILLTHKFKNKLIFAPVNLGL 302 Query: 201 -HWVLLAINVKAETIYYLDS 145 HWVLL IN E IYY+DS Sbjct: 303 NHWVLLVINPGVEMIYYMDS 322 >ref|XP_003613613.1| hypothetical protein MTR_5g038680 [Medicago truncatula] gi|355514948|gb|AES96571.1| hypothetical protein MTR_5g038680 [Medicago truncatula] Length = 414 Score = 65.9 bits (159), Expect = 5e-09 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 1/87 (1%) Frame = -2 Query: 381 RYLYENFMVQNQSSRRFFFLSPHETGFVLKKQEQQKSLVDLLVQNGAKDKLVLAPYNISV 202 R+LYEN + +F FLSPH + ++ +Q + + D+L+ + K+KL+ AP N+ + Sbjct: 261 RFLYENLIKPCGLVNKFSFLSPH----ISQEDKQGQQIADILLTHKFKNKLIFAPVNLGL 316 Query: 201 -HWVLLAINVKAETIYYLDSMHGDPVN 124 +WVLL IN AE IYY+DS+ G N Sbjct: 317 NYWVLLVINPGAEMIYYMDSLPGGHPN 343 >ref|XP_004514733.1| PREDICTED: uncharacterized protein LOC101503488 [Cicer arietinum] Length = 252 Score = 57.8 bits (138), Expect = 1e-06 Identities = 32/88 (36%), Positives = 48/88 (54%), Gaps = 1/88 (1%) Frame = -2 Query: 420 TKIVPPMHPITSLRYLYENFMVQNQSSRRFFFLSPHETG-FVLKKQEQQKSLVDLLVQNG 244 ++I+ I+ +LYE + + S F LS H+ F L +K +VD+L++N Sbjct: 165 SRIISMEEAISGDGFLYEKLVCTRELSDIFSLLSLHKLSMFKLDSVNVKKYVVDILLRNK 224 Query: 243 AKDKLVLAPYNISVHWVLLAINVKAETI 160 DKL LAPYN HWVL AIN ++ + Sbjct: 225 ENDKLFLAPYNSGAHWVLFAINATSDVM 252 >emb|CAN79827.1| hypothetical protein VITISV_006525 [Vitis vinifera] Length = 346 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/70 (40%), Positives = 45/70 (64%) Frame = -2 Query: 288 QEQQKSLVDLLVQNGAKDKLVLAPYNISVHWVLLAINVKAETIYYLDSMHGDPVNHRDMV 109 +++ + + D L+ + D L+ PYN HWVL I++K++TIYYLDS+ P ++D+ Sbjct: 242 EKRARFITDCLIDSKLAD-LIFLPYNPRFHWVLAIIDLKSQTIYYLDSLLQQP--YQDIK 298 Query: 108 DIFNMFYRFF 79 DI NM +R F Sbjct: 299 DIVNMGFRIF 308 >emb|CAN79821.1| hypothetical protein VITISV_020029 [Vitis vinifera] Length = 512 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/70 (38%), Positives = 44/70 (62%) Frame = -2 Query: 288 QEQQKSLVDLLVQNGAKDKLVLAPYNISVHWVLLAINVKAETIYYLDSMHGDPVNHRDMV 109 +++ + + D L+ + D L+ PYN HWVL I++K++T YYLDS+ P ++D+ Sbjct: 397 EKRARIIXDRLIDSKLAD-LIFLPYNXRFHWVLAVIDLKSQTXYYLDSLLQQP--YQDIK 453 Query: 108 DIFNMFYRFF 79 DI NM +R F Sbjct: 454 DIVNMXFRIF 463