BLASTX nr result
ID: Rehmannia24_contig00028656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00028656 (368 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74526.1| hypothetical protein M569_00243, partial [Genlise... 65 1e-08 emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] 55 1e-05 >gb|EPS74526.1| hypothetical protein M569_00243, partial [Genlisea aurea] Length = 66 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 367 NCMDKLTLTRQFGIQFDIFLGRYREGIGME 278 NCMDKLTLTRQFGI+FDIFLGRYREGIGME Sbjct: 37 NCMDKLTLTRQFGIKFDIFLGRYREGIGME 66 >emb|CAN66875.1| hypothetical protein VITISV_009275 [Vitis vinifera] Length = 142 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -2 Query: 367 NCMDKLTLTRQFGIQFDIFLGRYREGIGM 281 N MDKLTLTRQFGI F IFLGRYREGIGM Sbjct: 114 NRMDKLTLTRQFGIHFGIFLGRYREGIGM 142