BLASTX nr result
ID: Rehmannia24_contig00027451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00027451 (389 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509829.1| conserved hypothetical protein [Ricinus comm... 82 1e-13 >ref|XP_002509829.1| conserved hypothetical protein [Ricinus communis] gi|223549728|gb|EEF51216.1| conserved hypothetical protein [Ricinus communis] Length = 358 Score = 81.6 bits (200), Expect = 1e-13 Identities = 42/136 (30%), Positives = 73/136 (53%), Gaps = 11/136 (8%) Frame = -3 Query: 387 CLFVDRLRFGDGDKDNMIYHLYDETLLTYLG-----------KYGVLRTYQTKDNPPITS 241 C +DR+ N+++ YD TL ++ +Y + Q P T+ Sbjct: 58 CYIIDRI------SKNILHERYDLTLQEWINHLKRETINPIARYPIPHR-QGPTIPSHTA 110 Query: 240 NFVPKEYRKIIRDMIRFVIFLHTQKKSLGGLSLDNLVVKGDLLKFWKIKFVKANDDTKRN 61 N+VP EYRK+I+ M+ FV+ +H S G + N+V+K +++KFWK++F+ A+ +K N Sbjct: 111 NYVPNEYRKLIKSMVTFVVDIHDAGYSTAGFGMPNIVIKNEVVKFWKVQFITASMGSKNN 170 Query: 60 DFSLLASILRKLYEGQ 13 DF L ++ L+ G+ Sbjct: 171 DFICLHRVVESLFSGE 186