BLASTX nr result
ID: Rehmannia24_contig00027390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00027390 (348 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003596153.1| hypothetical protein MTR_2g068900 [Medicago ... 80 4e-13 ref|XP_004488443.1| PREDICTED: uncharacterized protein LOC101491... 68 1e-09 ref|XP_003589895.1| TNP1 [Medicago truncatula] gi|355478943|gb|A... 65 7e-09 ref|XP_003589878.1| Ubiquitin-like-specific protease [Medicago t... 65 7e-09 ref|XP_003613613.1| hypothetical protein MTR_5g038680 [Medicago ... 59 9e-07 ref|XP_003605954.1| hypothetical protein MTR_4g049480 [Medicago ... 55 1e-05 >ref|XP_003596153.1| hypothetical protein MTR_2g068900 [Medicago truncatula] gi|355485201|gb|AES66404.1| hypothetical protein MTR_2g068900 [Medicago truncatula] Length = 138 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/71 (49%), Positives = 53/71 (74%) Frame = -2 Query: 344 YRVVGSGKVFNIPGDKIHTRPLPIGHVKVSPEVAFEPDAILPLPIDDEGVTTMRDAIVTF 165 +R+V G V NI GDK+H +PLP G++KVS ++A E DA+LP+P D + +RDAI T+ Sbjct: 5 HRIVTKGMVHNILGDKLHHKPLPDGYLKVSIDIALEQDAVLPIPDDVADIRLVRDAIGTY 64 Query: 164 VAWPKNLITID 132 VAW +NL++++ Sbjct: 65 VAWQRNLVSLN 75 >ref|XP_004488443.1| PREDICTED: uncharacterized protein LOC101491713 [Cicer arietinum] Length = 241 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/66 (46%), Positives = 46/66 (69%) Frame = -2 Query: 338 VVGSGKVFNIPGDKIHTRPLPIGHVKVSPEVAFEPDAILPLPIDDEGVTTMRDAIVTFVA 159 + G G ++N G+ +H P+ +GHVKVSP +A EP A LP+ +D + +R+AI ++VA Sbjct: 115 MAGKGTLYNTLGEVLHHNPILVGHVKVSPVIALEPLAPLPILDNDGDMMFLREAIGSYVA 174 Query: 158 WPKNLI 141 WPKNLI Sbjct: 175 WPKNLI 180 >ref|XP_003589895.1| TNP1 [Medicago truncatula] gi|355478943|gb|AES60146.1| TNP1 [Medicago truncatula] Length = 316 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/69 (43%), Positives = 46/69 (66%) Frame = -2 Query: 341 RVVGSGKVFNIPGDKIHTRPLPIGHVKVSPEVAFEPDAILPLPIDDEGVTTMRDAIVTFV 162 R+V GK++N D +H + LP G+VKV +VA E +LP+P+++ V T+ +AI TFV Sbjct: 67 RLVAHGKLYNTSSDVLHNKKLPPGYVKVRIDVAVERKDLLPIPVEEGDVLTVGEAIGTFV 126 Query: 161 AWPKNLITI 135 AW NL+ + Sbjct: 127 AWELNLVKL 135 >ref|XP_003589878.1| Ubiquitin-like-specific protease [Medicago truncatula] gi|355478926|gb|AES60129.1| Ubiquitin-like-specific protease [Medicago truncatula] Length = 420 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/69 (43%), Positives = 46/69 (66%) Frame = -2 Query: 341 RVVGSGKVFNIPGDKIHTRPLPIGHVKVSPEVAFEPDAILPLPIDDEGVTTMRDAIVTFV 162 R+V GK++N D +H + LP G+VKV +VA E +LP+P+++ V T+ +AI TFV Sbjct: 83 RLVAHGKLYNTSSDVLHNKKLPPGYVKVRIDVAVERKDLLPIPVEEGDVLTVGEAIGTFV 142 Query: 161 AWPKNLITI 135 AW NL+ + Sbjct: 143 AWELNLVKL 151 >ref|XP_003613613.1| hypothetical protein MTR_5g038680 [Medicago truncatula] gi|355514948|gb|AES96571.1| hypothetical protein MTR_5g038680 [Medicago truncatula] Length = 414 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/61 (47%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Frame = -2 Query: 314 NIPG-DKIHTRPLPIGHVKVSPEVAFEPDAILPLPIDDEGVTTMRDAIVTFVAWPKNLIT 138 N+ G D +H + LP G+VKV +VA E A+LP+PI++ V T+ +AI TFVAW NL+ Sbjct: 103 NVTGSDVLHNKKLPSGYVKVRIDVAVERKALLPIPIEEGDVLTVGEAIWTFVAWQLNLVK 162 Query: 137 I 135 + Sbjct: 163 L 163 >ref|XP_003605954.1| hypothetical protein MTR_4g049480 [Medicago truncatula] gi|355507009|gb|AES88151.1| hypothetical protein MTR_4g049480 [Medicago truncatula] Length = 453 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/62 (40%), Positives = 40/62 (64%) Frame = -2 Query: 326 GKVFNIPGDKIHTRPLPIGHVKVSPEVAFEPDAILPLPIDDEGVTTMRDAIVTFVAWPKN 147 GK++N G+ +H LP G+VKV EV+ P+A+LP+ ++ E V+ + AI T V WP Sbjct: 216 GKLYNTEGNIVHDITLPPGYVKVKIEVSIVPNALLPISVEYEDVSMVGQAIGTIVPWPLK 275 Query: 146 LI 141 ++ Sbjct: 276 IL 277