BLASTX nr result
ID: Rehmannia24_contig00027359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00027359 (321 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68943.1| hypothetical protein M569_05824 [Genlisea aurea] 55 1e-05 >gb|EPS68943.1| hypothetical protein M569_05824 [Genlisea aurea] Length = 198 Score = 55.1 bits (131), Expect = 1e-05 Identities = 37/109 (33%), Positives = 49/109 (44%), Gaps = 2/109 (1%) Frame = -1 Query: 321 PPPTTMPTK--ESPPPVETLDSDFXXXXXXXXXXXXXXXXXXXXARCDWIRRITGRISTS 148 PPP + K E PP ++ +D+DF ARC WIRR+ G S Sbjct: 15 PPPESSSQKPAEVPPAMQAMDADFVVILAAMLCALICVLGLIAVARCAWIRRLGG--GES 72 Query: 147 VPSSEPPRSVANXXXXXXXXXXXXXLTYGEDEDQAEKLSECAICLAEFA 1 SS P + AN T+ ED A KLS+CAICL++F+ Sbjct: 73 AASSLP--AAANKGLKKKVLNSLPKTTFAEDSKLAAKLSDCAICLSDFS 119