BLASTX nr result
ID: Rehmannia24_contig00027318
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00027318 (549 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB28578.1| hypothetical protein L484_009737 [Morus notabilis] 56 5e-06 >gb|EXB28578.1| hypothetical protein L484_009737 [Morus notabilis] Length = 584 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/45 (62%), Positives = 35/45 (77%), Gaps = 3/45 (6%) Frame = +3 Query: 423 EGIGVTIKKKRSQTSRRPRPEGQS---LPDRSPMSSTPVSDDMSK 548 +GIG T++KKRSQT RRPRP+ Q+ D SPMSSTP SDD++K Sbjct: 11 DGIGNTVRKKRSQTCRRPRPDSQTHVENNDESPMSSTPPSDDVNK 55