BLASTX nr result
ID: Rehmannia24_contig00027221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00027221 (315 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362304.1| PREDICTED: GDP-mannose transporter GONST1-li... 60 2e-07 ref|XP_006362303.1| PREDICTED: GDP-mannose transporter GONST1-li... 60 2e-07 ref|XP_002274276.2| PREDICTED: GDP-mannose transporter GONST1-li... 59 7e-07 emb|CBI37536.3| unnamed protein product [Vitis vinifera] 59 7e-07 ref|XP_004250901.1| PREDICTED: GDP-mannose transporter GONST1-li... 58 1e-06 ref|XP_002522842.1| GDP-mannose transporter, putative [Ricinus c... 58 1e-06 gb|EOX92550.1| Golgi nucleotide sugar transporter 1 [Theobroma c... 56 6e-06 >ref|XP_006362304.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X2 [Solanum tuberosum] Length = 402 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/61 (52%), Positives = 42/61 (68%) Frame = +2 Query: 131 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 310 LLDQV R E+ SRSF MK N ND+ ++E G DIEK++RS +++TV N ALLSG Sbjct: 44 LLDQVSKSFRGEVVSRSFSMKAANRNDE-NLENGMLENDIEKSVRSNKVVTVHNKALLSG 102 Query: 311 L 313 + Sbjct: 103 V 103 >ref|XP_006362303.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X1 [Solanum tuberosum] Length = 403 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/61 (52%), Positives = 42/61 (68%) Frame = +2 Query: 131 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 310 LLDQV R E+ SRSF MK N ND+ ++E G DIEK++RS +++TV N ALLSG Sbjct: 45 LLDQVSKSFRGEVVSRSFSMKAANRNDE-NLENGMLENDIEKSVRSNKVVTVHNKALLSG 103 Query: 311 L 313 + Sbjct: 104 V 104 >ref|XP_002274276.2| PREDICTED: GDP-mannose transporter GONST1-like [Vitis vinifera] Length = 501 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/65 (44%), Positives = 43/65 (66%) Frame = +2 Query: 116 HQL*GLLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNP 295 H+ G+LDQV +RRE+ +RS P +++ D+E GK KD EK++RS R++ + N Sbjct: 18 HETNGVLDQVSSPLRREVLNRSVFSMKPLGSEETDLEDGKLEKDREKSVRSNRVVRIHNQ 77 Query: 296 ALLSG 310 ALLSG Sbjct: 78 ALLSG 82 >emb|CBI37536.3| unnamed protein product [Vitis vinifera] Length = 648 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/65 (44%), Positives = 43/65 (66%) Frame = +2 Query: 116 HQL*GLLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNP 295 H+ G+LDQV +RRE+ +RS P +++ D+E GK KD EK++RS R++ + N Sbjct: 286 HETNGVLDQVSSPLRREVLNRSVFSMKPLGSEETDLEDGKLEKDREKSVRSNRVVRIHNQ 345 Query: 296 ALLSG 310 ALLSG Sbjct: 346 ALLSG 350 >ref|XP_004250901.1| PREDICTED: GDP-mannose transporter GONST1-like [Solanum lycopersicum] Length = 402 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/61 (52%), Positives = 40/61 (65%) Frame = +2 Query: 131 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 310 LLDQV R E+ +RS MK N ND+ D+E G KDIEK++RS + TV N ALLSG Sbjct: 44 LLDQVSKSFRGEVVNRSLSMKAANRNDE-DLENGMLEKDIEKSVRSNKGFTVHNKALLSG 102 Query: 311 L 313 + Sbjct: 103 I 103 >ref|XP_002522842.1| GDP-mannose transporter, putative [Ricinus communis] gi|223537926|gb|EEF39540.1| GDP-mannose transporter, putative [Ricinus communis] Length = 485 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/66 (43%), Positives = 42/66 (63%) Frame = +2 Query: 116 HQL*GLLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNP 295 H+ G++DQ+ +R E+ +RS + ND+ID+E GK KD +K RS R L ++N Sbjct: 18 HESNGVVDQISSPLRNEVVNRSSFTMRSHENDEIDLEGGKLEKDRDKTTRSNRALKIQNQ 77 Query: 296 ALLSGL 313 ALLSGL Sbjct: 78 ALLSGL 83 >gb|EOX92550.1| Golgi nucleotide sugar transporter 1 [Theobroma cacao] Length = 398 Score = 55.8 bits (133), Expect = 6e-06 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 3/69 (4%) Frame = +2 Query: 116 HQL*GLLDQ---VPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTV 286 H+ G+LDQ V VRR++ SRS + D++D+E+GK KD +K +RS +I+ + Sbjct: 35 HESNGVLDQGHQVSSPVRRDVVSRSLSAVKVHEKDEMDLESGKLEKDRDKTIRSNKIVKI 94 Query: 287 RNPALLSGL 313 +N ALLSGL Sbjct: 95 QNQALLSGL 103