BLASTX nr result
ID: Rehmannia24_contig00027078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00027078 (411 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517182.1| conserved hypothetical protein [Ricinus comm... 66 5e-09 ref|XP_006380064.1| hypothetical protein POPTR_0008s20830g, part... 64 2e-08 gb|EXB55018.1| hypothetical protein L484_007349 [Morus notabilis] 63 5e-08 gb|EMJ28079.1| hypothetical protein PRUPE_ppa016713mg [Prunus pe... 63 5e-08 gb|ESW19748.1| hypothetical protein PHAVU_006G152200g [Phaseolus... 60 4e-07 gb|ACU16828.1| unknown [Glycine max] 59 7e-07 ref|XP_004486303.1| PREDICTED: uncharacterized protein LOC101499... 58 1e-06 ref|XP_006489317.1| PREDICTED: uncharacterized protein LOC102609... 56 6e-06 >ref|XP_002517182.1| conserved hypothetical protein [Ricinus communis] gi|223543817|gb|EEF45345.1| conserved hypothetical protein [Ricinus communis] Length = 244 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/41 (68%), Positives = 37/41 (90%) Frame = +1 Query: 94 RRRKMGGTTKMNAMRSGVVVVGALAFGYLTLQLGFKPFLEK 216 RR++M TK+NA+RSG+VV+GALAFGYLT ++GFKPFLE+ Sbjct: 10 RRKRMNPQTKLNAIRSGIVVIGALAFGYLTFEIGFKPFLER 50 >ref|XP_006380064.1| hypothetical protein POPTR_0008s20830g, partial [Populus trichocarpa] gi|550333563|gb|ERP57861.1| hypothetical protein POPTR_0008s20830g, partial [Populus trichocarpa] Length = 92 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 5/56 (8%) Frame = +1 Query: 64 RKTGNLKKELRRRKMGGTT-----KMNAMRSGVVVVGALAFGYLTLQLGFKPFLEK 216 RK+G ++E RR+ G + K+NA+RSG+VV+GALAFGYLTLQ+GFKPFL K Sbjct: 10 RKSGEGREEERRQVKGKESMKAEDKLNAIRSGIVVIGALAFGYLTLQIGFKPFLLK 65 >gb|EXB55018.1| hypothetical protein L484_007349 [Morus notabilis] Length = 64 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +1 Query: 121 KMNAMRSGVVVVGALAFGYLTLQLGFKPFLEK 216 KMNAMRSGVVVVGA+AFGYLTL LGFKPFLEK Sbjct: 6 KMNAMRSGVVVVGAMAFGYLTLYLGFKPFLEK 37 >gb|EMJ28079.1| hypothetical protein PRUPE_ppa016713mg [Prunus persica] Length = 66 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +1 Query: 118 TKMNAMRSGVVVVGALAFGYLTLQLGFKPFLEK 216 TK+NAMRSGVVV+GALAFGYLTLQLGF+PFLE+ Sbjct: 5 TKVNAMRSGVVVLGALAFGYLTLQLGFRPFLER 37 >gb|ESW19748.1| hypothetical protein PHAVU_006G152200g [Phaseolus vulgaris] Length = 67 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 103 KMGGTTKMNAMRSGVVVVGALAFGYLTLQLGFKPFLEK 216 K G KMNA+RSG+VV+G LAFGYL++Q+GFKP+LEK Sbjct: 4 KPGSDMKMNAIRSGIVVLGTLAFGYLSIQIGFKPYLEK 41 >gb|ACU16828.1| unknown [Glycine max] Length = 68 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 103 KMGGTTKMNAMRSGVVVVGALAFGYLTLQLGFKPFLEK 216 K G KMNA+RSG+VV+GALA GYL++Q+GFKP+LEK Sbjct: 4 KPGSDMKMNAIRSGIVVLGALALGYLSIQIGFKPYLEK 41 >ref|XP_004486303.1| PREDICTED: uncharacterized protein LOC101499193 [Cicer arietinum] Length = 236 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/32 (75%), Positives = 32/32 (100%) Frame = +1 Query: 121 KMNAMRSGVVVVGALAFGYLTLQLGFKPFLEK 216 KMNA+RSG+VV+GA+AFGYL++Q+GFKP+LEK Sbjct: 10 KMNAIRSGIVVLGAIAFGYLSIQIGFKPYLEK 41 >ref|XP_006489317.1| PREDICTED: uncharacterized protein LOC102609245 [Citrus sinensis] Length = 62 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 121 KMNAMRSGVVVVGALAFGYLTLQLGFKPFLEK 216 KMNA+RSG+VVVG LAFGYL+L+LGFKPFL K Sbjct: 6 KMNAIRSGIVVVGFLAFGYLSLELGFKPFLLK 37