BLASTX nr result
ID: Rehmannia24_contig00026987
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00026987 (387 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004232170.1| PREDICTED: 50S ribosomal protein L7/L12-like... 69 8e-10 ref|XP_002521510.1| 50S ribosomal protein L7/L12, putative [Rici... 68 1e-09 ref|XP_006338377.1| PREDICTED: 54S ribosomal protein L12, mitoch... 67 2e-09 ref|XP_004149984.1| PREDICTED: 54S ribosomal protein L12, mitoch... 62 6e-08 ref|XP_004287857.1| PREDICTED: 54S ribosomal protein L12, mitoch... 59 7e-07 gb|EMJ01773.1| hypothetical protein PRUPE_ppa011851mg [Prunus pe... 58 1e-06 gb|EMJ03867.1| hypothetical protein PRUPE_ppa012443mg [Prunus pe... 57 2e-06 gb|EOX90970.1| 50S ribosomal protein L7/L12, putative [Theobroma... 57 3e-06 ref|XP_002275239.1| PREDICTED: 60 ribosomal protein L12, mitocho... 55 7e-06 >ref|XP_004232170.1| PREDICTED: 50S ribosomal protein L7/L12-like [Solanum lycopersicum] Length = 207 Score = 68.6 bits (166), Expect = 8e-10 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -1 Query: 186 FSASAQESKPAPSERVFGIVDEISGLTLLEISDLTEVLRKK 64 F+ SAQESKPAPSERV IVDEISGLTLLE+SDL EVLRKK Sbjct: 56 FTTSAQESKPAPSERVSAIVDEISGLTLLEVSDLGEVLRKK 96 >ref|XP_002521510.1| 50S ribosomal protein L7/L12, putative [Ricinus communis] gi|223539188|gb|EEF40781.1| 50S ribosomal protein L7/L12, putative [Ricinus communis] Length = 192 Score = 67.8 bits (164), Expect = 1e-09 Identities = 46/84 (54%), Positives = 58/84 (69%), Gaps = 7/84 (8%) Frame = -1 Query: 294 MRH------HCTRLVSQTLLRRPITPSPQIESPLKNPNLIRCFSASAQE-SKPAPSERVF 136 MRH H +R + +TL R P T +PQ P ++PNLI F++ AQE + PAPS++V Sbjct: 1 MRHFRLISPHLSR-IRKTLFRNP-TFNPQSTIP-RSPNLIYQFTSIAQEPNPPAPSDKVA 57 Query: 135 GIVDEISGLTLLEISDLTEVLRKK 64 +VDEIS LTLLEISDLTEVLR K Sbjct: 58 ALVDEISELTLLEISDLTEVLRNK 81 >ref|XP_006338377.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like [Solanum tuberosum] Length = 207 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -1 Query: 186 FSASAQESKPAPSERVFGIVDEISGLTLLEISDLTEVLRKK 64 F+ SAQESKP PSERV IVDEISGLTLLE+SDL EVLRKK Sbjct: 56 FTTSAQESKPVPSERVSAIVDEISGLTLLEVSDLGEVLRKK 96 >ref|XP_004149984.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like [Cucumis sativus] gi|449491404|ref|XP_004158886.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like isoform 1 [Cucumis sativus] gi|449491408|ref|XP_004158887.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like isoform 2 [Cucumis sativus] Length = 202 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = -1 Query: 192 RCFSASAQESKPAPSERVFGIVDEISGLTLLEISDLTEVLRKK 64 R ++ ++ ES+PAPSERV IVDEISGLTLLE++DLTEVLR+K Sbjct: 49 RNYTTASPESRPAPSERVSAIVDEISGLTLLEVADLTEVLREK 91 >ref|XP_004287857.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 188 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/74 (43%), Positives = 48/74 (64%), Gaps = 3/74 (4%) Frame = -1 Query: 276 RLVSQTL--LRRPITPSPQIES-PLKNPNLIRCFSASAQESKPAPSERVFGIVDEISGLT 106 RL+S L + + + +P + S P + + + ++ +A + +P P E V I DE+SGLT Sbjct: 5 RLISPQLSQIHKTLHQNPNLRSRPHLSSHFVATYTTAAPQKRPPPPENVSAIADEVSGLT 64 Query: 105 LLEISDLTEVLRKK 64 LLEISDLTEVLR+K Sbjct: 65 LLEISDLTEVLREK 78 >gb|EMJ01773.1| hypothetical protein PRUPE_ppa011851mg [Prunus persica] Length = 193 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/63 (49%), Positives = 39/63 (61%), Gaps = 14/63 (22%) Frame = -1 Query: 210 KNPNLIRC--------------FSASAQESKPAPSERVFGIVDEISGLTLLEISDLTEVL 73 ++PNL+ C ++ A E +P PSE V I DEISGLTLLE+SDLTEVL Sbjct: 21 QSPNLLSCLQSKPRICSHFVCNYTTDAPEQRPPPSETVSAIADEISGLTLLEVSDLTEVL 80 Query: 72 RKK 64 R+K Sbjct: 81 REK 83 >gb|EMJ03867.1| hypothetical protein PRUPE_ppa012443mg [Prunus persica] Length = 169 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = -1 Query: 231 PQIESPLKNPNLIRCFSASAQESKPAPSERVFGIVDEISGLTLLEISDLTEVLRKK 64 PQI S + + ++ +A E +P PSE V I DEISGLTLLE+SDLTEVLR+K Sbjct: 32 PQISS-----HFVCNYTTAAPEQRPPPSETVSAIADEISGLTLLEVSDLTEVLREK 82 >gb|EOX90970.1| 50S ribosomal protein L7/L12, putative [Theobroma cacao] Length = 196 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/72 (45%), Positives = 49/72 (68%), Gaps = 6/72 (8%) Frame = -1 Query: 261 TLLRRPITPSPQIESPLKNPNLI-----RCFSASAQES-KPAPSERVFGIVDEISGLTLL 100 T +++ + +P I S +++ N + R ++ +QES K APS +V IVDE+SGLTLL Sbjct: 12 TRIQKTLHQNPNISSSIQSLNKVNHTFSRNYTTPSQESTKQAPSGKVAAIVDELSGLTLL 71 Query: 99 EISDLTEVLRKK 64 E+ DLTEVLR+K Sbjct: 72 EVMDLTEVLRQK 83 >ref|XP_002275239.1| PREDICTED: 60 ribosomal protein L12, mitochondrial [Vitis vinifera] Length = 189 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -1 Query: 201 NLIRCFSASAQESKPAPSERVFGIVDEISGLTLLEISDLTEVLRKK 64 N + +++SAQ PSERV IVDEISGLTLLE+SDLTE+LRKK Sbjct: 40 NFVLKYTSSAQ----VPSERVSSIVDEISGLTLLEVSDLTELLRKK 81