BLASTX nr result
ID: Rehmannia24_contig00026934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00026934 (560 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68330.1| hypothetical protein M569_06437 [Genlisea aurea] 56 5e-06 >gb|EPS68330.1| hypothetical protein M569_06437 [Genlisea aurea] Length = 1373 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/46 (60%), Positives = 29/46 (63%) Frame = -2 Query: 139 MMISRGLFGWSPPHIQPLTXXXXXXXXXXXXXPYMDMGTGEAEPVE 2 MMISRGLFGWSPPHIQPLT PY+D GTGE VE Sbjct: 1 MMISRGLFGWSPPHIQPLTPVSEVSEPPESPSPYLDSGTGEPVAVE 46