BLASTX nr result
ID: Rehmannia24_contig00026876
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00026876 (357 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004232757.1| PREDICTED: uncharacterized protein LOC101266... 60 3e-07 ref|XP_006365876.1| PREDICTED: uncharacterized protein LOC102601... 59 7e-07 >ref|XP_004232757.1| PREDICTED: uncharacterized protein LOC101266475 [Solanum lycopersicum] Length = 421 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -2 Query: 158 MPAVWFALKRSMRCKSEQRDVYDPNTKNGNKNLSKISTKK 39 MPAVWFALK+S++C+SE +DVYDP ++ KNLSKISTKK Sbjct: 1 MPAVWFALKKSLQCRSEIKDVYDPRSE--GKNLSKISTKK 38 >ref|XP_006365876.1| PREDICTED: uncharacterized protein LOC102601024 [Solanum tuberosum] Length = 417 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -2 Query: 158 MPAVWFALKRSMRCKSEQRDVYDPNTKNGNKNLSKISTKK 39 MPAVWFALK+S++C+SE +DVYDP ++ +NLSKISTKK Sbjct: 1 MPAVWFALKKSLQCRSEIKDVYDP--RSDGRNLSKISTKK 38