BLASTX nr result
ID: Rehmannia24_contig00026407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00026407 (375 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32677.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|XP_002278566.1| PREDICTED: diaminopimelate epimerase, chloro... 71 2e-10 ref|XP_006844286.1| hypothetical protein AMTR_s00145p00090730 [A... 68 1e-09 gb|EMJ06606.1| hypothetical protein PRUPE_ppa007581mg [Prunus pe... 68 1e-09 gb|ACR35767.1| unknown [Zea mays] 66 4e-09 ref|NP_001141344.1| uncharacterized protein LOC100273435 [Zea ma... 66 4e-09 gb|ACF84249.1| unknown [Zea mays] 66 4e-09 gb|EOY07617.1| Diaminopimelate epimerase family protein isoform ... 66 5e-09 ref|XP_004173638.1| PREDICTED: diaminopimelate epimerase, chloro... 66 5e-09 ref|XP_004142088.1| PREDICTED: diaminopimelate epimerase, chloro... 66 5e-09 ref|XP_002308231.2| hypothetical protein POPTR_0006s10360g [Popu... 65 7e-09 ref|XP_006374003.1| hypothetical protein POPTR_0016s12850g [Popu... 65 7e-09 ref|XP_002323003.2| hypothetical protein POPTR_0016s12850g [Popu... 65 7e-09 ref|XP_004962722.1| PREDICTED: diaminopimelate epimerase, chloro... 65 7e-09 ref|XP_004962721.1| PREDICTED: diaminopimelate epimerase, chloro... 65 7e-09 ref|XP_004302726.1| PREDICTED: diaminopimelate epimerase, chloro... 65 7e-09 tpg|DAA47058.1| TPA: hypothetical protein ZEAMMB73_238513 [Zea m... 65 7e-09 tpg|DAA47055.1| TPA: diaminopimelate epimerase isoform 1 [Zea ma... 65 7e-09 ref|NP_001130140.1| uncharacterized protein LOC100191234 [Zea ma... 65 7e-09 ref|XP_004246745.1| PREDICTED: diaminopimelate epimerase, chloro... 65 9e-09 >emb|CBI32677.3| unnamed protein product [Vitis vinifera] Length = 307 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSVPL 275 LPGGPLDI WRE+DNHVYMTGPAE+VFYGSVPL Sbjct: 275 LPGGPLDIEWREEDNHVYMTGPAEIVFYGSVPL 307 >ref|XP_002278566.1| PREDICTED: diaminopimelate epimerase, chloroplastic [Vitis vinifera] Length = 370 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSVPL 275 LPGGPLDI WRE+DNHVYMTGPAE+VFYGSVPL Sbjct: 338 LPGGPLDIEWREEDNHVYMTGPAEIVFYGSVPL 370 >ref|XP_006844286.1| hypothetical protein AMTR_s00145p00090730 [Amborella trichopoda] gi|548846695|gb|ERN05961.1| hypothetical protein AMTR_s00145p00090730 [Amborella trichopoda] Length = 386 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSVPL 275 LPGG L+I WREDDNHVYMTGPAELVFYGSVPL Sbjct: 354 LPGGLLEIEWREDDNHVYMTGPAELVFYGSVPL 386 >gb|EMJ06606.1| hypothetical protein PRUPE_ppa007581mg [Prunus persica] Length = 363 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSVPL 275 LPGGPL I WRE+DNH+YMTGPAE+VFYGSVPL Sbjct: 331 LPGGPLQIEWREEDNHIYMTGPAEVVFYGSVPL 363 >gb|ACR35767.1| unknown [Zea mays] Length = 350 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSV 281 LPGGPL+I WREDDNHVYMTGPAE+VFYGSV Sbjct: 318 LPGGPLEIEWREDDNHVYMTGPAEVVFYGSV 348 >ref|NP_001141344.1| uncharacterized protein LOC100273435 [Zea mays] gi|194704094|gb|ACF86131.1| unknown [Zea mays] gi|223948299|gb|ACN28233.1| unknown [Zea mays] gi|414878077|tpg|DAA55208.1| TPA: hypothetical protein ZEAMMB73_842737 [Zea mays] Length = 353 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSV 281 LPGGPL+I WREDDNHVYMTGPAE+VFYGSV Sbjct: 321 LPGGPLEIEWREDDNHVYMTGPAEVVFYGSV 351 >gb|ACF84249.1| unknown [Zea mays] Length = 308 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSV 281 LPGGPL+I WREDDNHVYMTGPAE+VFYGSV Sbjct: 276 LPGGPLEIEWREDDNHVYMTGPAEVVFYGSV 306 >gb|EOY07617.1| Diaminopimelate epimerase family protein isoform 1 [Theobroma cacao] Length = 361 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSVPL 275 LPGG L+I WRE+DNHVYMTGPAE+VFYGSVPL Sbjct: 329 LPGGTLEIEWREEDNHVYMTGPAEVVFYGSVPL 361 >ref|XP_004173638.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like, partial [Cucumis sativus] Length = 172 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSVPL 275 LPGGPL I W E+DNHVYMTGPAE+VFYGSVPL Sbjct: 139 LPGGPLQIEWSEEDNHVYMTGPAEVVFYGSVPL 171 >ref|XP_004142088.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Cucumis sativus] Length = 364 Score = 65.9 bits (159), Expect = 5e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSVPL 275 LPGGPL I W E+DNHVYMTGPAE+VFYGSVPL Sbjct: 331 LPGGPLQIEWSEEDNHVYMTGPAEVVFYGSVPL 363 >ref|XP_002308231.2| hypothetical protein POPTR_0006s10360g [Populus trichocarpa] gi|550335915|gb|EEE91754.2| hypothetical protein POPTR_0006s10360g [Populus trichocarpa] Length = 366 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSVPL 275 LPGGPL+I WRE+DNHVYMTGPAE+VFYGSV L Sbjct: 334 LPGGPLEIEWREEDNHVYMTGPAEVVFYGSVRL 366 >ref|XP_006374003.1| hypothetical protein POPTR_0016s12850g [Populus trichocarpa] gi|550321383|gb|ERP51800.1| hypothetical protein POPTR_0016s12850g [Populus trichocarpa] Length = 368 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSVPL 275 LPGGPL+I WRE+DNHVYMTGPAE+VF GSVPL Sbjct: 331 LPGGPLEIEWREEDNHVYMTGPAEMVFDGSVPL 363 >ref|XP_002323003.2| hypothetical protein POPTR_0016s12850g [Populus trichocarpa] gi|550321382|gb|EEF04764.2| hypothetical protein POPTR_0016s12850g [Populus trichocarpa] Length = 363 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSVPL 275 LPGGPL+I WRE+DNHVYMTGPAE+VF GSVPL Sbjct: 326 LPGGPLEIEWREEDNHVYMTGPAEMVFDGSVPL 358 >ref|XP_004962722.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like isoform X2 [Setaria italica] Length = 357 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSV 281 LPGGPL+I WREDDNHVYMTGPAE VFYGSV Sbjct: 325 LPGGPLEIEWREDDNHVYMTGPAEAVFYGSV 355 >ref|XP_004962721.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like isoform X1 [Setaria italica] Length = 358 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSV 281 LPGGPL+I WREDDNHVYMTGPAE VFYGSV Sbjct: 326 LPGGPLEIEWREDDNHVYMTGPAEAVFYGSV 356 >ref|XP_004302726.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 362 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSVPL 275 LPGGPL I W E+DNH+YMTGPAE+VFYGSVPL Sbjct: 330 LPGGPLQIEWSEEDNHIYMTGPAEVVFYGSVPL 362 >tpg|DAA47058.1| TPA: hypothetical protein ZEAMMB73_238513 [Zea mays] Length = 349 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSV 281 LPGGPL+I WREDDNHVYMTGPAE VFYGSV Sbjct: 317 LPGGPLEIEWREDDNHVYMTGPAEAVFYGSV 347 >tpg|DAA47055.1| TPA: diaminopimelate epimerase isoform 1 [Zea mays] gi|414868499|tpg|DAA47056.1| TPA: diaminopimelate epimerase isoform 2 [Zea mays] gi|414868500|tpg|DAA47057.1| TPA: diaminopimelate epimerase isoform 3 [Zea mays] Length = 352 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSV 281 LPGGPL+I WREDDNHVYMTGPAE VFYGSV Sbjct: 320 LPGGPLEIEWREDDNHVYMTGPAEAVFYGSV 350 >ref|NP_001130140.1| uncharacterized protein LOC100191234 [Zea mays] gi|194688384|gb|ACF78276.1| unknown [Zea mays] gi|195608480|gb|ACG26070.1| diaminopimelate epimerase [Zea mays] gi|219888355|gb|ACL54552.1| unknown [Zea mays] Length = 352 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSV 281 LPGGPL+I WREDDNHVYMTGPAE VFYGSV Sbjct: 320 LPGGPLEIEWREDDNHVYMTGPAEAVFYGSV 350 >ref|XP_004246745.1| PREDICTED: diaminopimelate epimerase, chloroplastic-like [Solanum lycopersicum] Length = 363 Score = 65.1 bits (157), Expect = 9e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -3 Query: 373 LPGGPLDIVWREDDNHVYMTGPAELVFYGSVPL 275 LPGGPLDI W E DNH+YMTGPAE+VFYGS PL Sbjct: 331 LPGGPLDIEWSEKDNHIYMTGPAEVVFYGSAPL 363