BLASTX nr result
ID: Rehmannia24_contig00026367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00026367 (386 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631444.1| PREDICTED: uncharacterized protein LOC100855... 65 9e-09 emb|CAN75750.1| hypothetical protein VITISV_032952 [Vitis vinifera] 65 9e-09 ref|XP_002525906.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 ref|XP_006440336.1| hypothetical protein CICLE_v10022879mg [Citr... 60 2e-07 gb|EMJ12458.1| hypothetical protein PRUPE_ppa022084mg [Prunus pe... 59 7e-07 ref|XP_006368201.1| hypothetical protein POPTR_0001s00460g [Popu... 59 9e-07 ref|XP_002329915.1| predicted protein [Populus trichocarpa] 59 9e-07 ref|XP_003538729.1| PREDICTED: uncharacterized protein LOC100806... 55 7e-06 >ref|XP_003631444.1| PREDICTED: uncharacterized protein LOC100855013 [Vitis vinifera] gi|297741181|emb|CBI31912.3| unnamed protein product [Vitis vinifera] Length = 187 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = +1 Query: 61 RMQLWKRTERSTLESPPCNAEENVRSKTNDTVEDVDVMDYAQPHRKPPTHNR 216 +++ WKR R L S P + EE V SK D VED+ VMDYAQPHRKPP HN+ Sbjct: 134 KIEGWKRHSRLMLGSAPHDVEETVDSKEGDIVEDIVVMDYAQPHRKPPIHNK 185 >emb|CAN75750.1| hypothetical protein VITISV_032952 [Vitis vinifera] Length = 183 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/52 (57%), Positives = 36/52 (69%) Frame = +1 Query: 61 RMQLWKRTERSTLESPPCNAEENVRSKTNDTVEDVDVMDYAQPHRKPPTHNR 216 +++ WKR R L S P + EE V SK D VED+ VMDYAQPHRKPP HN+ Sbjct: 130 KIEGWKRHSRLMLGSAPHDVEETVDSKEGDIVEDIVVMDYAQPHRKPPIHNK 181 >ref|XP_002525906.1| conserved hypothetical protein [Ricinus communis] gi|223534820|gb|EEF36510.1| conserved hypothetical protein [Ricinus communis] Length = 179 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = +1 Query: 73 WKRTERSTLESPPCNAEENVRSKTNDTVEDVDVMDYAQPHRKPPTHN 213 +KR ER +ES P + EE V+S ND ED VMDYAQPHRKPP HN Sbjct: 130 FKRQERFMIESAPSDTEEAVKSNENDIAEDAVVMDYAQPHRKPPIHN 176 >ref|XP_006440336.1| hypothetical protein CICLE_v10022879mg [Citrus clementina] gi|557542598|gb|ESR53576.1| hypothetical protein CICLE_v10022879mg [Citrus clementina] Length = 123 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/46 (65%), Positives = 30/46 (65%) Frame = +1 Query: 76 KRTERSTLESPPCNAEENVRSKTNDTVEDVDVMDYAQPHRKPPTHN 213 K R L SPP N E V SK ND VED VMDYAQPHRKPP HN Sbjct: 75 KAQARFLLGSPPGNTNEAVDSKENDFVEDAVVMDYAQPHRKPPIHN 120 >gb|EMJ12458.1| hypothetical protein PRUPE_ppa022084mg [Prunus persica] Length = 323 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/53 (56%), Positives = 35/53 (66%) Frame = +1 Query: 58 IRMQLWKRTERSTLESPPCNAEENVRSKTNDTVEDVDVMDYAQPHRKPPTHNR 216 I MQ KR R+ L S N EE+ SK ++ +E V VMDYAQPHRKPP HNR Sbjct: 269 IEMQGLKRQARTLLGSATHNMEEDKDSKEDEAIEVVGVMDYAQPHRKPPIHNR 321 >ref|XP_006368201.1| hypothetical protein POPTR_0001s00460g [Populus trichocarpa] gi|550346100|gb|ERP64770.1| hypothetical protein POPTR_0001s00460g [Populus trichocarpa] Length = 183 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/43 (65%), Positives = 31/43 (72%) Frame = +1 Query: 88 RSTLESPPCNAEENVRSKTNDTVEDVDVMDYAQPHRKPPTHNR 216 RS L S + EE VRS+ ND EDV VMDYAQPHRKPP HN+ Sbjct: 139 RSMLGSTANDTEEAVRSEENDIAEDVAVMDYAQPHRKPPIHNK 181 >ref|XP_002329915.1| predicted protein [Populus trichocarpa] Length = 183 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/43 (65%), Positives = 31/43 (72%) Frame = +1 Query: 88 RSTLESPPCNAEENVRSKTNDTVEDVDVMDYAQPHRKPPTHNR 216 RS L S + EE VRS+ ND EDV VMDYAQPHRKPP HN+ Sbjct: 139 RSMLGSTANDTEEAVRSEENDIAEDVAVMDYAQPHRKPPIHNK 181 >ref|XP_003538729.1| PREDICTED: uncharacterized protein LOC100806817 [Glycine max] Length = 177 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/46 (58%), Positives = 31/46 (67%) Frame = +1 Query: 76 KRTERSTLESPPCNAEENVRSKTNDTVEDVDVMDYAQPHRKPPTHN 213 +R RS L N EE V +KT+DT ED+ MDYAQPHRKPP HN Sbjct: 129 RRHARSMLGPAEHNDEETVVTKTSDTEEDIVEMDYAQPHRKPPIHN 174