BLASTX nr result
ID: Rehmannia24_contig00026355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00026355 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006363989.1| PREDICTED: uncharacterized protein LOC102601... 65 7e-09 ref|XP_004235367.1| PREDICTED: uncharacterized protein LOC101248... 63 3e-08 >ref|XP_006363989.1| PREDICTED: uncharacterized protein LOC102601007 [Solanum tuberosum] Length = 421 Score = 65.5 bits (158), Expect = 7e-09 Identities = 44/93 (47%), Positives = 57/93 (61%) Frame = +2 Query: 68 METMAVSRSSFSSLAYVRPYRAVQSGTTRPDTLRVRSRSLPSGSSVRQKLLISHMKFGKR 247 MET RS FS + Y +P +A G+ D +RV S+ S S ++ ISH+K R Sbjct: 1 METATAFRSGFS-ICY-KPTKASLDGS---DFVRVGSQLRMSPSGIKLYPSISHVKLSNR 55 Query: 248 EMSFVNRKQTEIRASVQASDYGGSADPIAPLQL 346 ++SF +RK T IRASV S+ GGSA PIAPLQL Sbjct: 56 KVSFGSRKYTAIRASVSPSESGGSAAPIAPLQL 88 >ref|XP_004235367.1| PREDICTED: uncharacterized protein LOC101248757 isoform 1 [Solanum lycopersicum] gi|460379232|ref|XP_004235368.1| PREDICTED: uncharacterized protein LOC101248757 isoform 2 [Solanum lycopersicum] Length = 421 Score = 63.2 bits (152), Expect = 3e-08 Identities = 41/93 (44%), Positives = 53/93 (56%) Frame = +2 Query: 68 METMAVSRSSFSSLAYVRPYRAVQSGTTRPDTLRVRSRSLPSGSSVRQKLLISHMKFGKR 247 MET RS FS RA ++ D +RV S+ S S ++ ISH+K R Sbjct: 1 METATAFRSGFSICN-----RATKAALGGSDFVRVGSQLRMSPSGIKLYPSISHVKLSNR 55 Query: 248 EMSFVNRKQTEIRASVQASDYGGSADPIAPLQL 346 +++F +RK T IRASV S+ GGSA PIAPLQL Sbjct: 56 KVAFGSRKYTAIRASVSPSESGGSAAPIAPLQL 88