BLASTX nr result
ID: Rehmannia24_contig00026303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00026303 (426 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003548336.1| PREDICTED: MACPF domain-containing protein A... 57 3e-06 gb|EMJ23249.1| hypothetical protein PRUPE_ppa003112mg [Prunus pe... 56 4e-06 gb|EXB30759.1| hypothetical protein L484_001374 [Morus notabilis] 55 1e-05 ref|XP_002526447.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_003548336.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform X1 [Glycine max] gi|571524280|ref|XP_006598796.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform X2 [Glycine max] gi|571524286|ref|XP_006598797.1| PREDICTED: MACPF domain-containing protein At4g24290-like isoform X3 [Glycine max] Length = 604 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 425 GFWVVSGARLVIEKGKICLSIKYSLLTMDLPVEEM 321 G+WVVSGA+LV++KGKI L +KYSLLTM LP EEM Sbjct: 566 GYWVVSGAKLVVDKGKISLRVKYSLLTMVLPDEEM 600 >gb|EMJ23249.1| hypothetical protein PRUPE_ppa003112mg [Prunus persica] Length = 602 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = -2 Query: 425 GFWVVSGARLVIEKGKICLSIKYSLLTMDLPVEEMQ 318 G+WVVSGARLV+EKG+I L +KYSLLT+ LP EE++ Sbjct: 565 GYWVVSGARLVVEKGRISLRVKYSLLTVILPDEELE 600 >gb|EXB30759.1| hypothetical protein L484_001374 [Morus notabilis] Length = 604 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 425 GFWVVSGARLVIEKGKICLSIKYSLLTMDLPVEEM 321 G+WVVSGARLV+EKG+I L +KYSLLT+ LP EE+ Sbjct: 566 GYWVVSGARLVVEKGRISLRVKYSLLTVILPDEEV 600 >ref|XP_002526447.1| conserved hypothetical protein [Ricinus communis] gi|223534227|gb|EEF35942.1| conserved hypothetical protein [Ricinus communis] Length = 603 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -2 Query: 425 GFWVVSGARLVIEKGKICLSIKYSLLTMDLPVEEMQ 318 G+WVVSGARLV+EKG+I L +KYSLLT+ LP E+++ Sbjct: 565 GYWVVSGARLVVEKGRISLRVKYSLLTVVLPDEDLE 600