BLASTX nr result
ID: Rehmannia24_contig00024776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00024776 (557 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citr... 65 8e-09 >ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] gi|557522886|gb|ESR34253.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] Length = 71 Score = 65.5 bits (158), Expect = 8e-09 Identities = 35/69 (50%), Positives = 40/69 (57%) Frame = -3 Query: 369 FLSYPGGGNGKQRDIAHFPRTNKVTTIKRKIFLYYCP*TAVFQYENRPALIFLSIQHDPT 190 F SYPGGGNGKQRDIA K ++ L Y P A+FQ N P + LS+ H PT Sbjct: 4 FFSYPGGGNGKQRDIAQNAGIQKANIFDKRKSLNYFP-VALFQERNEPVTMLLSMHHVPT 62 Query: 189 LISSFNILP 163 ISSFN P Sbjct: 63 FISSFNNPP 71