BLASTX nr result
ID: Rehmannia24_contig00024364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00024364 (360 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313321.2| hypothetical protein POPTR_0009s06170g [Popu... 62 8e-08 ref|XP_004303091.1| PREDICTED: uncharacterized protein LOC101301... 60 2e-07 ref|XP_002299925.2| hypothetical protein POPTR_0001s26940g [Popu... 60 3e-07 gb|EOX96624.1| Uncharacterized protein TCM_005838 [Theobroma cacao] 59 7e-07 gb|ESW03396.1| hypothetical protein PHAVU_011G010800g [Phaseolus... 59 9e-07 gb|EPS68523.1| hypothetical protein M569_06248 [Genlisea aurea] 58 1e-06 gb|ESW34477.1| hypothetical protein PHAVU_001G156100g [Phaseolus... 57 2e-06 ref|XP_004515954.1| PREDICTED: uncharacterized protein LOC101506... 57 2e-06 gb|EMJ21316.1| hypothetical protein PRUPE_ppa021262mg [Prunus pe... 57 2e-06 ref|XP_002273809.1| PREDICTED: uncharacterized protein LOC100255... 56 4e-06 >ref|XP_002313321.2| hypothetical protein POPTR_0009s06170g [Populus trichocarpa] gi|550331139|gb|EEE87276.2| hypothetical protein POPTR_0009s06170g [Populus trichocarpa] Length = 90 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +1 Query: 1 KEMDGDAESSKFINNCNEEKAATAAIEDGGESSIIKSQPDSASGAK 138 KEMD D E SKFINNCNE KAATAA ++GG+ SI+K P+ A AK Sbjct: 42 KEMDADRELSKFINNCNEIKAATAANKEGGQLSIVKPPPEPARAAK 87 >ref|XP_004303091.1| PREDICTED: uncharacterized protein LOC101301698 [Fragaria vesca subsp. vesca] Length = 88 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +1 Query: 1 KEMDGDAESSKFINNCNEEKAATAAIEDGGESSIIKSQPDSASGAK 138 K+MD D E +KFIN+CNE KAATAA ++GG+ SI+K+ P+S SG K Sbjct: 42 KDMDTDREITKFINHCNEVKAATAANKEGGQLSIVKNPPESDSGGK 87 >ref|XP_002299925.2| hypothetical protein POPTR_0001s26940g [Populus trichocarpa] gi|118485495|gb|ABK94602.1| unknown [Populus trichocarpa] gi|550348276|gb|EEE84730.2| hypothetical protein POPTR_0001s26940g [Populus trichocarpa] Length = 88 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = +1 Query: 1 KEMDGDAESSKFINNCNEEKAATAAIEDGGESSIIKSQPDSASGAK 138 +EMD D E SKFINNCNE KAATAA ++GG+ SI+K ++AS AK Sbjct: 42 EEMDADRELSKFINNCNEIKAATAANKEGGQLSIVKPPTETASAAK 87 >gb|EOX96624.1| Uncharacterized protein TCM_005838 [Theobroma cacao] Length = 88 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +1 Query: 1 KEMDGDAESSKFINNCNEEKAATAAIEDGGESSIIKSQPDSASGAK 138 K+MD D E +KFIN CNE KAAT A +DGG+ +I+K PDSAS K Sbjct: 42 KDMDADRELTKFINQCNEIKAATIANKDGGQLNIVKLPPDSASDVK 87 >gb|ESW03396.1| hypothetical protein PHAVU_011G010800g [Phaseolus vulgaris] Length = 87 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +1 Query: 1 KEMDGDAESSKFINNCNEEKAATAAIEDGGESSIIKSQPDSASGAK 138 KEMD D E SKFIN CNE KAAT A +DGG+ IIK + SGAK Sbjct: 42 KEMDADREVSKFINQCNEIKAATLATKDGGQLGIIKHPSEQPSGAK 87 >gb|EPS68523.1| hypothetical protein M569_06248 [Genlisea aurea] Length = 87 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 1 KEMDGDAESSKFINNCNEEKAATAAIEDGGESSIIK-SQPDSAS 129 KEMD D E SKFIN CNE KAAT A +DGG+ SI+K QPDSA+ Sbjct: 42 KEMDADKELSKFINRCNEIKAATFANKDGGQLSIVKHQQPDSAT 85 >gb|ESW34477.1| hypothetical protein PHAVU_001G156100g [Phaseolus vulgaris] Length = 87 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +1 Query: 1 KEMDGDAESSKFINNCNEEKAATAAIEDGGESSIIKSQPDSASGAK 138 KEMD D E SKFIN CNE KAAT A +DGG+ IIK + SGAK Sbjct: 42 KEMDADREVSKFINQCNEIKAATLATKDGGQLGIIKHPVELPSGAK 87 >ref|XP_004515954.1| PREDICTED: uncharacterized protein LOC101506844 [Cicer arietinum] Length = 89 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = +1 Query: 1 KEMDGDAESSKFINNCNEEKAATAAIEDGGESSIIKSQPDSASGA 135 K+MD D E SKFIN+CNE KAA A +DGG SI+K+ +SASGA Sbjct: 42 KDMDADREVSKFINHCNEIKAAAVATKDGGFLSIVKTGQESASGA 86 >gb|EMJ21316.1| hypothetical protein PRUPE_ppa021262mg [Prunus persica] Length = 89 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +1 Query: 4 EMDGDAESSKFINNCNEEKAATAAIEDGGESSIIKSQPDSASGAK 138 +MD D E +KFIN CNE KAATAA ++GG+ SI+K+ DS S AK Sbjct: 43 DMDADREITKFINQCNEVKAATAANKEGGQLSIVKTPQDSGSNAK 87 >ref|XP_002273809.1| PREDICTED: uncharacterized protein LOC100255155 [Vitis vinifera] gi|297736337|emb|CBI24975.3| unnamed protein product [Vitis vinifera] Length = 88 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +1 Query: 1 KEMDGDAESSKFINNCNEEKAATAAIEDGGESSIIKSQPDSASGAK 138 KEMD D E SKFIN+CNE KAAT A ++GG+ SI+K+ + ++ AK Sbjct: 42 KEMDADREVSKFINHCNEVKAATVANKEGGQLSIVKTPSEPSNAAK 87