BLASTX nr result
ID: Rehmannia24_contig00024313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00024313 (315 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004503627.1| PREDICTED: toll-like receptor 13-like isofor... 63 5e-08 ref|XP_003525346.1| PREDICTED: toll-like receptor 7-like isoform... 56 6e-06 >ref|XP_004503627.1| PREDICTED: toll-like receptor 13-like isoform X1 [Cicer arietinum] Length = 589 Score = 62.8 bits (151), Expect = 5e-08 Identities = 35/69 (50%), Positives = 50/69 (72%), Gaps = 2/69 (2%) Frame = +1 Query: 1 QIELRHEFVETI--DKRNFHYSSPSRVTMKRTLQCKQKQGKLSMSPLRSDEIFLDQRLKY 174 QIE+RHE V + ++ H+SSPSR+T RT+Q +K+ ++S+SP F+DQR+KY Sbjct: 505 QIEIRHELVTLLPFEENGRHHSSPSRLT-SRTMQAARKKEQMSLSPY-----FVDQRMKY 558 Query: 175 SREELLALQ 201 SR+ELLALQ Sbjct: 559 SRDELLALQ 567 >ref|XP_003525346.1| PREDICTED: toll-like receptor 7-like isoform X1 [Glycine max] gi|571456937|ref|XP_006580526.1| PREDICTED: toll-like receptor 7-like isoform X2 [Glycine max] gi|571456939|ref|XP_006580527.1| PREDICTED: toll-like receptor 7-like isoform X3 [Glycine max] Length = 589 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/69 (46%), Positives = 48/69 (69%), Gaps = 2/69 (2%) Frame = +1 Query: 1 QIELRHEF--VETIDKRNFHYSSPSRVTMKRTLQCKQKQGKLSMSPLRSDEIFLDQRLKY 174 Q+E+RHE + +++ ++SSPSR T K T+Q +K+ ++ +SP F+DQRLKY Sbjct: 505 QVEVRHELGTLFPVNQNGLNHSSPSRSTSK-TMQMTKKKDQIPLSPY-----FVDQRLKY 558 Query: 175 SREELLALQ 201 SR+ELLALQ Sbjct: 559 SRDELLALQ 567