BLASTX nr result
ID: Rehmannia24_contig00024242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00024242 (340 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006342026.1| PREDICTED: auxin response factor 5-like [Sol... 92 5e-17 ref|NP_001234545.1| auxin response factor 5 [Solanum lycopersicu... 90 3e-16 gb|EXB58397.1| Auxin response factor 5 [Morus notabilis] 89 8e-16 gb|EOY14976.1| Transcriptional factor B3 family protein / auxin-... 85 1e-14 gb|EMJ26551.1| hypothetical protein PRUPE_ppa000946mg [Prunus pe... 83 4e-14 gb|AAO14628.1|AF467900_5 hypothetical transcription factor [Prun... 82 6e-14 ref|XP_002300719.2| hypothetical protein POPTR_0002s02630g [Popu... 81 1e-13 ref|XP_003634382.1| PREDICTED: auxin response factor 5-like isof... 81 1e-13 ref|XP_003634381.1| PREDICTED: auxin response factor 5-like isof... 81 1e-13 emb|CBI19831.3| unnamed protein product [Vitis vinifera] 81 1e-13 ref|XP_004499235.1| PREDICTED: auxin response factor 5-like [Cic... 79 5e-13 gb|EPS64438.1| hypothetical protein M569_10340, partial [Genlise... 79 6e-13 ref|XP_006601343.1| PREDICTED: auxin response factor 5-like [Gly... 79 8e-13 ref|XP_003544394.2| PREDICTED: auxin response factor 5-like [Gly... 79 8e-13 gb|ESW32677.1| hypothetical protein PHAVU_001G008200g [Phaseolus... 79 8e-13 ref|XP_002510508.1| Auxin response factor, putative [Ricinus com... 79 8e-13 ref|XP_006435146.1| hypothetical protein CICLE_v10000183mg [Citr... 78 1e-12 gb|AHC30881.1| auxin response factor [Dimocarpus longan] 77 2e-12 gb|EPS61777.1| auxin response factor 5, partial [Genlisea aurea] 77 2e-12 ref|XP_004147836.1| PREDICTED: auxin response factor 5-like [Cuc... 77 2e-12 >ref|XP_006342026.1| PREDICTED: auxin response factor 5-like [Solanum tuberosum] Length = 929 Score = 92.4 bits (228), Expect = 5e-17 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGSTLE 141 DDPWEEFVGCV+CIRILSP+EVQQMGEEGMQLLNS G+QG+NGST E Sbjct: 880 DDPWEEFVGCVRCIRILSPTEVQQMGEEGMQLLNSAGLQGINGSTSE 926 >ref|NP_001234545.1| auxin response factor 5 [Solanum lycopersicum] gi|300253180|gb|ADJ96592.1| auxin response factor 5 [Solanum lycopersicum] gi|310697420|gb|ADP06665.1| auxin response factor 5 [Solanum lycopersicum] Length = 930 Score = 90.1 bits (222), Expect = 3e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGSTLE 141 DDPWEEFVGCV+CIRILSP+EVQQMGEEGMQLLNS G+Q +NGST E Sbjct: 881 DDPWEEFVGCVRCIRILSPTEVQQMGEEGMQLLNSAGLQSINGSTSE 927 >gb|EXB58397.1| Auxin response factor 5 [Morus notabilis] Length = 940 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGSTLEVG 147 DDPWEEFVGCV+CIRILSP+EVQQM EEGM+LLNS +QG+NGS LE G Sbjct: 890 DDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAAMQGINGSILEAG 938 >gb|EOY14976.1| Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related [Theobroma cacao] Length = 951 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/50 (78%), Positives = 44/50 (88%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGSTLEVGC 150 DDPWEEFVGCV+CIRILSP+EVQQM EEGM+LLNS VQG+NG+ E GC Sbjct: 901 DDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSATVQGINGTNSE-GC 949 >gb|EMJ26551.1| hypothetical protein PRUPE_ppa000946mg [Prunus persica] Length = 953 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGSTLE 141 DDPWEEFVGCV+CIRILSP+EVQQM EEGM+LLNS +QG+NG+ E Sbjct: 902 DDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAAMQGINGTMSE 948 >gb|AAO14628.1|AF467900_5 hypothetical transcription factor [Prunus persica] Length = 954 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/49 (73%), Positives = 43/49 (87%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGSTLEVG 147 DDPWEEFVGCV+CIRILSP+EVQQM EEG++LLNS +QG+NG+ E G Sbjct: 904 DDPWEEFVGCVRCIRILSPTEVQQMSEEGIKLLNSAAMQGINGTMSEGG 952 >ref|XP_002300719.2| hypothetical protein POPTR_0002s02630g [Populus trichocarpa] gi|550344136|gb|EEE79992.2| hypothetical protein POPTR_0002s02630g [Populus trichocarpa] Length = 933 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVN 126 DDPWEEFVGCV+CIRILSPSEVQQM EEGM+LLNS +QG+N Sbjct: 883 DDPWEEFVGCVRCIRILSPSEVQQMSEEGMKLLNSANIQGIN 924 >ref|XP_003634382.1| PREDICTED: auxin response factor 5-like isoform 2 [Vitis vinifera] Length = 947 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGS 132 DDPW+EFVGCV+CIRILSPSEVQQM EEGMQLLNS ++G+N S Sbjct: 901 DDPWKEFVGCVRCIRILSPSEVQQMSEEGMQLLNSTAIEGINDS 944 >ref|XP_003634381.1| PREDICTED: auxin response factor 5-like isoform 1 [Vitis vinifera] Length = 925 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGS 132 DDPW+EFVGCV+CIRILSPSEVQQM EEGMQLLNS ++G+N S Sbjct: 879 DDPWKEFVGCVRCIRILSPSEVQQMSEEGMQLLNSTAIEGINDS 922 >emb|CBI19831.3| unnamed protein product [Vitis vinifera] Length = 907 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGS 132 DDPW+EFVGCV+CIRILSPSEVQQM EEGMQLLNS ++G+N S Sbjct: 861 DDPWKEFVGCVRCIRILSPSEVQQMSEEGMQLLNSTAIEGINDS 904 >ref|XP_004499235.1| PREDICTED: auxin response factor 5-like [Cicer arietinum] Length = 917 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVN 126 DDPWEEFVGCV+CIRILSPSEVQQM EEGM+LLNS +QG+N Sbjct: 875 DDPWEEFVGCVRCIRILSPSEVQQMSEEGMKLLNSGALQGIN 916 >gb|EPS64438.1| hypothetical protein M569_10340, partial [Genlisea aurea] Length = 720 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGV 123 DDPWEEFVGCV+CIRILSPSEV+QMGEEGMQLLNSVG G+ Sbjct: 680 DDPWEEFVGCVRCIRILSPSEVRQMGEEGMQLLNSVGGIGM 720 >ref|XP_006601343.1| PREDICTED: auxin response factor 5-like [Glycine max] Length = 933 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVN 126 DDPWEEFVGCV+CIRILSPSEVQQM EEGM+LLNS +QG+N Sbjct: 891 DDPWEEFVGCVRCIRILSPSEVQQMSEEGMKLLNSGALQGMN 932 >ref|XP_003544394.2| PREDICTED: auxin response factor 5-like [Glycine max] Length = 930 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVN 126 DDPWEEFVGCV+CIRILSPSEVQQM EEGM+LLNS +QG+N Sbjct: 888 DDPWEEFVGCVRCIRILSPSEVQQMSEEGMKLLNSGALQGMN 929 >gb|ESW32677.1| hypothetical protein PHAVU_001G008200g [Phaseolus vulgaris] Length = 937 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVN 126 DDPWEEFVGCV+CIRILSPSEVQQM EEGM+LLNS +QG+N Sbjct: 895 DDPWEEFVGCVRCIRILSPSEVQQMSEEGMKLLNSGALQGMN 936 >ref|XP_002510508.1| Auxin response factor, putative [Ricinus communis] gi|223551209|gb|EEF52695.1| Auxin response factor, putative [Ricinus communis] Length = 950 Score = 78.6 bits (192), Expect = 8e-13 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGS 132 DDPWEEFVGCV+CIRILSPSEVQQM EEGM+LLN+V +QG+ S Sbjct: 900 DDPWEEFVGCVRCIRILSPSEVQQMSEEGMKLLNNVNMQGLAAS 943 >ref|XP_006435146.1| hypothetical protein CICLE_v10000183mg [Citrus clementina] gi|557537268|gb|ESR48386.1| hypothetical protein CICLE_v10000183mg [Citrus clementina] Length = 946 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGSTLEVG 147 DDPWEEFVGCV+CIRILSP EVQQM EEGM+LLNS +QG++ + E G Sbjct: 896 DDPWEEFVGCVRCIRILSPQEVQQMSEEGMKLLNSAAMQGIDCTKPEGG 944 >gb|AHC30881.1| auxin response factor [Dimocarpus longan] Length = 942 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGS 132 DDPWEEFVGCV+CIRILSP EVQQM EEGM+LLNS +QG++ S Sbjct: 892 DDPWEEFVGCVRCIRILSPQEVQQMSEEGMKLLNSAAMQGIDCS 935 >gb|EPS61777.1| auxin response factor 5, partial [Genlisea aurea] Length = 632 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSV 108 DDPWEEFVGCVKCIRILSPSEV+QMGEEGMQLLNSV Sbjct: 597 DDPWEEFVGCVKCIRILSPSEVKQMGEEGMQLLNSV 632 >ref|XP_004147836.1| PREDICTED: auxin response factor 5-like [Cucumis sativus] gi|449476870|ref|XP_004154860.1| PREDICTED: auxin response factor 5-like [Cucumis sativus] Length = 949 Score = 77.4 bits (189), Expect = 2e-12 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = +1 Query: 1 DDPWEEFVGCVKCIRILSPSEVQQMGEEGMQLLNSVGVQGVNGSTLEVG 147 DDPWEEFV CV+CIRILSPSEVQQM EEGM+LLNS +QG+N E G Sbjct: 899 DDPWEEFVSCVRCIRILSPSEVQQMSEEGMKLLNSAMMQGINCPMSEGG 947