BLASTX nr result
ID: Rehmannia24_contig00023787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00023787 (312 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ20017.1| hypothetical protein PRUPE_ppa010063mg [Prunus pe... 57 3e-06 >gb|EMJ20017.1| hypothetical protein PRUPE_ppa010063mg [Prunus persica] Length = 266 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/71 (45%), Positives = 43/71 (60%), Gaps = 14/71 (19%) Frame = +2 Query: 140 MSFLEKFLLFLTILPSACFSEETFD------PVIVEWPE--------INEARKLQCTSWR 277 M+FL+ FL F + S FS+ETF P+I+E+PE + E KL CTSWR Sbjct: 1 MTFLKIFLFFPLL--SLAFSQETFTSHLLPRPLIIEYPENTETNFRELEEEFKLHCTSWR 58 Query: 278 VAVEANNLSPW 310 +VEANN++PW Sbjct: 59 FSVEANNINPW 69