BLASTX nr result
ID: Rehmannia24_contig00023663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00023663 (328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71393.1| hypothetical protein M569_03373 [Genlisea aurea] 63 4e-08 ref|XP_002316854.1| hypothetical protein POPTR_0011s11040g [Popu... 62 8e-08 gb|EXB22357.1| hypothetical protein L484_004350 [Morus notabilis] 60 3e-07 >gb|EPS71393.1| hypothetical protein M569_03373 [Genlisea aurea] Length = 60 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -2 Query: 324 IPLPAGEVVRTKLVRLLYFVGAGAVCAVGINKWKDIERKSMIQEQ 190 +P+P GE V KL+RLL+FVGAG + GINKWK++E+KS IQ+Q Sbjct: 3 VPVPPGEEVAPKLIRLLWFVGAGVLSVAGINKWKELEKKSAIQKQ 47 >ref|XP_002316854.1| hypothetical protein POPTR_0011s11040g [Populus trichocarpa] gi|222859919|gb|EEE97466.1| hypothetical protein POPTR_0011s11040g [Populus trichocarpa] Length = 71 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = -2 Query: 315 PAGEVVRTKLVRLLYFVGAGAVCAVGINKWKDIERKSMIQEQQQ 184 PAG K++RLLYFVGAG +C VGINKW++IERKS++++QQQ Sbjct: 10 PAGP----KVLRLLYFVGAGFICTVGINKWREIERKSILEQQQQ 49 >gb|EXB22357.1| hypothetical protein L484_004350 [Morus notabilis] Length = 58 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -2 Query: 315 PAGEVVRTKLVRLLYFVGAGAVCAVGINKWKDIERKSMIQEQQQ 184 PAG KLVRLLYFVGAG +C VGINKW+D +RKSM+ + Q Sbjct: 9 PAGP----KLVRLLYFVGAGFICVVGINKWRDFQRKSMLSQHDQ 48