BLASTX nr result
ID: Rehmannia24_contig00020916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00020916 (443 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77841.1| hypothetical protein VITISV_015562 [Vitis vinifera] 55 7e-06 >emb|CAN77841.1| hypothetical protein VITISV_015562 [Vitis vinifera] Length = 383 Score = 55.5 bits (132), Expect = 7e-06 Identities = 30/55 (54%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = -2 Query: 433 KGFRRVQSDGNLEELANASYNNVDDLS---FSKKFARKPNFCTLEAIPSFSHHNL 278 +GFRR QSDGNL+ LA AS NN D+LS SKK +++P+ L+ IPSFS + L Sbjct: 133 RGFRRAQSDGNLKGLAYASCNNNDELSTPNLSKKSSQRPSRSMLQTIPSFSFYGL 187