BLASTX nr result
ID: Rehmannia24_contig00020584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00020584 (466 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324390.2| hypothetical protein POPTR_0018s03610g [Popu... 66 4e-09 ref|XP_006845609.1| hypothetical protein AMTR_s00019p00209010 [A... 65 7e-09 gb|EOY29220.1| Ribosomal L28 family, putative [Theobroma cacao] 65 9e-09 ref|XP_006450181.1| hypothetical protein CICLE_v10009422mg [Citr... 63 4e-08 gb|EPS72501.1| hypothetical protein M569_02258, partial [Genlise... 62 6e-08 ref|XP_004146126.1| PREDICTED: uncharacterized protein LOC101212... 62 6e-08 ref|XP_004245117.1| PREDICTED: uncharacterized protein LOC101264... 62 1e-07 ref|XP_002527543.1| 60S ribosomal protein L24, mitochondrial pre... 61 2e-07 ref|XP_006355319.1| PREDICTED: 54S ribosomal protein L24, mitoch... 60 2e-07 ref|XP_004291293.1| PREDICTED: 39S ribosomal protein L28, mitoch... 59 7e-07 gb|AFK38646.1| unknown [Lotus japonicus] 59 7e-07 gb|AFK45117.1| unknown [Lotus japonicus] 59 9e-07 ref|XP_003588460.1| 50S ribosomal protein L28 [Medicago truncatu... 58 1e-06 ref|XP_004498490.1| PREDICTED: 54S ribosomal protein L24, mitoch... 57 2e-06 ref|XP_006412588.1| hypothetical protein EUTSA_v10026230mg [Eutr... 56 6e-06 ref|XP_006284519.1| hypothetical protein CARUB_v10005720mg [Caps... 55 1e-05 gb|EMJ27291.1| hypothetical protein PRUPE_ppa010814mg [Prunus pe... 55 1e-05 ref|XP_002867301.1| ribosomal protein L28 family protein [Arabid... 55 1e-05 ref|NP_194874.1| ribosomal L28 family protein [Arabidopsis thali... 55 1e-05 >ref|XP_002324390.2| hypothetical protein POPTR_0018s03610g [Populus trichocarpa] gi|550317955|gb|EEF02955.2| hypothetical protein POPTR_0018s03610g [Populus trichocarpa] Length = 229 Score = 66.2 bits (160), Expect = 4e-09 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 GE+NLAPGVKE LKK+ N KVVM +A+RG AG IQFG+ +SEDGGNK Sbjct: 18 GEKNLAPGVKEALKKAIPNSKVVMNRAKRGLFAGRHIQFGNQISEDGGNK 67 >ref|XP_006845609.1| hypothetical protein AMTR_s00019p00209010 [Amborella trichopoda] gi|548848181|gb|ERN07284.1| hypothetical protein AMTR_s00019p00209010 [Amborella trichopoda] Length = 223 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTT-NKVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 G++N APGVKE LKK NKVVMG+A+RG AG IQFG+ VSEDGGNK Sbjct: 17 GDENFAPGVKESLKKYLPDNKVVMGRAKRGLYAGRHIQFGNQVSEDGGNK 66 >gb|EOY29220.1| Ribosomal L28 family, putative [Theobroma cacao] Length = 258 Score = 65.1 bits (157), Expect = 9e-09 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 GE NLAPGVKEQLKK + KVVM +A+RG AG IQFG+ +SEDGGNK Sbjct: 17 GENNLAPGVKEQLKKCIPDSKVVMNRAKRGLYAGRHIQFGNRISEDGGNK 66 >ref|XP_006450181.1| hypothetical protein CICLE_v10009422mg [Citrus clementina] gi|568860087|ref|XP_006483558.1| PREDICTED: 54S ribosomal protein L24, mitochondrial-like [Citrus sinensis] gi|557553407|gb|ESR63421.1| hypothetical protein CICLE_v10009422mg [Citrus clementina] Length = 222 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 GE+NLAPGVKE LKK + ++VM +A+RG AG IQFG+ VSEDGGNK Sbjct: 18 GEKNLAPGVKESLKKCVPDSRIVMNRAKRGLFAGKHIQFGNRVSEDGGNK 67 >gb|EPS72501.1| hypothetical protein M569_02258, partial [Genlisea aurea] Length = 179 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/49 (65%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 310 EQNLAPGVKEQLKKSTTNK-VVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 E +LAPGVK+QLKK +K +VMG+AQRG AG IQFG+ +SEDGGNK Sbjct: 19 EHDLAPGVKDQLKKWLPDKKIVMGRAQRGLYAGKHIQFGNRISEDGGNK 67 >ref|XP_004146126.1| PREDICTED: uncharacterized protein LOC101212331 [Cucumis sativus] gi|449528875|ref|XP_004171427.1| PREDICTED: uncharacterized LOC101212331 [Cucumis sativus] Length = 221 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 GE NLAPGVK+ LKK + K+VMG+A RG AG I+FG+ VSEDGGNK Sbjct: 17 GENNLAPGVKDSLKKCIPDSKIVMGRANRGIYAGRHIRFGNRVSEDGGNK 66 >ref|XP_004245117.1| PREDICTED: uncharacterized protein LOC101264655 isoform 1 [Solanum lycopersicum] gi|460399177|ref|XP_004245118.1| PREDICTED: uncharacterized protein LOC101264655 isoform 2 [Solanum lycopersicum] Length = 211 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/49 (67%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGN 450 GE+NLA GVKE+L+K N KVVMG+AQRG AG IQFG+ VSE GGN Sbjct: 18 GEKNLASGVKERLEKCVPNAKVVMGRAQRGLFAGRHIQFGNRVSEKGGN 66 >ref|XP_002527543.1| 60S ribosomal protein L24, mitochondrial precursor, putative [Ricinus communis] gi|223533093|gb|EEF34852.1| 60S ribosomal protein L24, mitochondrial precursor, putative [Ricinus communis] Length = 211 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 G+ NL+P VKE LKK + KVVMG+A+RG AG IQFG+ VSEDGGNK Sbjct: 17 GDNNLSPEVKESLKKCMPDSKVVMGRAKRGIFAGRHIQFGNRVSEDGGNK 66 >ref|XP_006355319.1| PREDICTED: 54S ribosomal protein L24, mitochondrial-like [Solanum tuberosum] Length = 211 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/49 (65%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGN 450 GE+NLA GVK++L+K N KVVMG+AQRG AG IQFG+ VSE GGN Sbjct: 18 GEKNLASGVKQRLEKCVPNAKVVMGRAQRGLFAGRHIQFGNRVSEKGGN 66 >ref|XP_004291293.1| PREDICTED: 39S ribosomal protein L28, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 221 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/51 (58%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN--KVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 G++NL P +K++LKK+ K+VMG+AQRG AG IQFG+ VSEDGGNK Sbjct: 17 GDKNLNPRLKQELKKNRLPDPKIVMGRAQRGIFAGRHIQFGNNVSEDGGNK 67 >gb|AFK38646.1| unknown [Lotus japonicus] Length = 235 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 GE+NL P KE L+K K+VMG+A+RG AG IQFG+ VSEDGGNK Sbjct: 17 GEKNLTPKAKESLQKCIPKTKIVMGRAKRGLFAGRHIQFGNTVSEDGGNK 66 >gb|AFK45117.1| unknown [Lotus japonicus] Length = 235 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 GE+NL+P KE L+K K+VMG+A+RG AG IQFG+ VSEDGGNK Sbjct: 17 GEKNLSPKSKESLQKCIPKTKIVMGRAKRGLFAGRHIQFGNTVSEDGGNK 66 >ref|XP_003588460.1| 50S ribosomal protein L28 [Medicago truncatula] gi|355477508|gb|AES58711.1| 50S ribosomal protein L28 [Medicago truncatula] Length = 232 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKK-STTNKVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 G++NL P KE ++K NKVVMG+A+RG AG IQFG+ VSEDGGN+ Sbjct: 17 GDKNLTPRAKESIEKWLPKNKVVMGRAKRGLFAGKHIQFGNSVSEDGGNR 66 >ref|XP_004498490.1| PREDICTED: 54S ribosomal protein L24, mitochondrial-like [Cicer arietinum] Length = 235 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTT-NKVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 GE+N+ P +K+ L+KS +K+VM +A+RG AG IQFG+ VSEDGGNK Sbjct: 17 GEKNMTPRLKQSLEKSLPKSKIVMNRAKRGLFAGKHIQFGNSVSEDGGNK 66 >ref|XP_006412588.1| hypothetical protein EUTSA_v10026230mg [Eutrema salsugineum] gi|557113758|gb|ESQ54041.1| hypothetical protein EUTSA_v10026230mg [Eutrema salsugineum] Length = 213 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 G +NL P +KE+LK + KVVMG+A+RG AG IQ+G+ VSEDGGNK Sbjct: 17 GPENLTPELKEKLKACVPDSKVVMGRAKRGLYAGRHIQYGNRVSEDGGNK 66 >ref|XP_006284519.1| hypothetical protein CARUB_v10005720mg [Capsella rubella] gi|565445879|ref|XP_006284520.1| hypothetical protein CARUB_v10005720mg [Capsella rubella] gi|482553224|gb|EOA17417.1| hypothetical protein CARUB_v10005720mg [Capsella rubella] gi|482553225|gb|EOA17418.1| hypothetical protein CARUB_v10005720mg [Capsella rubella] Length = 213 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 G +N+ P +KE+LK + KVVMG+A+RG AG IQ+G+ VSEDGGNK Sbjct: 17 GAENITPELKEKLKACVPDAKVVMGRAKRGLYAGRHIQYGNRVSEDGGNK 66 >gb|EMJ27291.1| hypothetical protein PRUPE_ppa010814mg [Prunus persica] Length = 235 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/51 (50%), Positives = 38/51 (74%), Gaps = 2/51 (3%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTT--NKVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 G++ L P ++E+LKK +K++MG+A+RG AG IQFG+ +SEDGGNK Sbjct: 36 GDKTLPPRLREELKKQGVPDSKIIMGRAKRGIYAGRHIQFGNQISEDGGNK 86 >ref|XP_002867301.1| ribosomal protein L28 family protein [Arabidopsis lyrata subsp. lyrata] gi|297313137|gb|EFH43560.1| ribosomal protein L28 family protein [Arabidopsis lyrata subsp. lyrata] Length = 212 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 G +N+ P +KE+LK + KVVMG+A+RG AG IQ+G+ VSEDGGNK Sbjct: 17 GAENITPELKEKLKACVPDTKVVMGRAKRGLYAGRHIQYGNRVSEDGGNK 66 >ref|NP_194874.1| ribosomal L28 family protein [Arabidopsis thaliana] gi|15724234|gb|AAL06510.1|AF412057_1 AT4g31460/F3L17_30 [Arabidopsis thaliana] gi|5262757|emb|CAB45905.1| putative protein [Arabidopsis thaliana] gi|7270049|emb|CAB79864.1| putative protein [Arabidopsis thaliana] gi|21593391|gb|AAM65340.1| unknown [Arabidopsis thaliana] gi|30102482|gb|AAP21159.1| At4g31460/F3L17_30 [Arabidopsis thaliana] gi|332660516|gb|AEE85916.1| ribosomal L28 family protein [Arabidopsis thaliana] Length = 212 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 307 GEQNLAPGVKEQLKKSTTN-KVVMGQAQRGFLAG*RIQFGSCVSEDGGNK 453 G +N+ P +KE+LK + KVVMG+A+RG AG IQ+G+ VSEDGGNK Sbjct: 17 GAENITPELKEKLKACVPDTKVVMGRAKRGLYAGRHIQYGNRVSEDGGNK 66