BLASTX nr result
ID: Rehmannia24_contig00020048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00020048 (362 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC13619.1| Brefeldin A-inhibited guanine nucleotide-exchange... 60 3e-07 ref|XP_006836552.1| hypothetical protein AMTR_s00131p00043500 [A... 59 7e-07 ref|XP_004287686.1| PREDICTED: brefeldin A-inhibited guanine nuc... 59 7e-07 ref|XP_004134353.1| PREDICTED: brefeldin A-inhibited guanine nuc... 59 7e-07 emb|CBI27735.3| unnamed protein product [Vitis vinifera] 59 7e-07 emb|CAN66773.1| hypothetical protein VITISV_006775 [Vitis vinifera] 59 7e-07 ref|XP_006658699.1| PREDICTED: brefeldin A-inhibited guanine nuc... 58 1e-06 ref|XP_006353133.1| PREDICTED: brefeldin A-inhibited guanine nuc... 58 1e-06 gb|EMT08768.1| Brefeldin A-inhibited guanine nucleotide-exchange... 58 1e-06 gb|EMS61589.1| Brefeldin A-inhibited guanine nucleotide-exchange... 58 1e-06 ref|XP_004252155.1| PREDICTED: brefeldin A-inhibited guanine nuc... 58 1e-06 ref|NP_001060005.1| Os07g0564700 [Oryza sativa Japonica Group] g... 58 1e-06 ref|XP_003560084.1| PREDICTED: brefeldin A-inhibited guanine nuc... 58 1e-06 gb|EEE67420.1| hypothetical protein OsJ_24760 [Oryza sativa Japo... 58 1e-06 gb|EAY95525.1| hypothetical protein OsI_17371 [Oryza sativa Indi... 58 1e-06 ref|XP_002309445.2| hypothetical protein POPTR_0006s23350g [Popu... 58 1e-06 gb|EPS63136.1| hypothetical protein M569_11651 [Genlisea aurea] 58 1e-06 ref|XP_002309444.1| predicted protein [Populus trichocarpa] 58 1e-06 ref|XP_006474544.1| PREDICTED: brefeldin A-inhibited guanine nuc... 57 2e-06 ref|XP_006452929.1| hypothetical protein CICLE_v10007246mg [Citr... 57 2e-06 >gb|EXC13619.1| Brefeldin A-inhibited guanine nucleotide-exchange protein 1 [Morus notabilis] Length = 1756 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 RDFYP +TKL+CCDQ+++RGALADLF QL LLP Sbjct: 1722 RDFYPLLTKLVCCDQMDVRGALADLFRAQLKALLP 1756 >ref|XP_006836552.1| hypothetical protein AMTR_s00131p00043500 [Amborella trichopoda] gi|548839091|gb|ERM99405.1| hypothetical protein AMTR_s00131p00043500 [Amborella trichopoda] Length = 1920 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +1 Query: 4 DFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 +FYP ITKL+CCDQ++IRGALADLF QL++LLP Sbjct: 1887 EFYPLITKLVCCDQMDIRGALADLFNTQLTSLLP 1920 >ref|XP_004287686.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 5-like [Fragaria vesca subsp. vesca] Length = 1770 Score = 58.9 bits (141), Expect = 7e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 RDFYP +TKL+CCDQ++IRGAL DLF QL LLP Sbjct: 1736 RDFYPLLTKLVCCDQMDIRGALGDLFRAQLKALLP 1770 >ref|XP_004134353.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Cucumis sativus] gi|449480318|ref|XP_004155860.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Cucumis sativus] Length = 1783 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 R+FYP +TKL+CCDQ++IRGAL DLF +QL LLP Sbjct: 1749 REFYPLLTKLVCCDQIDIRGALGDLFKIQLKALLP 1783 >emb|CBI27735.3| unnamed protein product [Vitis vinifera] Length = 1778 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 R+FYP ITKL+CCDQ+++RGAL DLF+ QL+ LLP Sbjct: 1744 REFYPLITKLVCCDQMDVRGALGDLFSTQLNALLP 1778 >emb|CAN66773.1| hypothetical protein VITISV_006775 [Vitis vinifera] Length = 251 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 R+FYP ITKL+CCDQ+++RGAL DLF+ QL+ LLP Sbjct: 217 REFYPLITKLVCCDQMDVRGALGDLFSTQLNALLP 251 >ref|XP_006658699.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 5-like [Oryza brachyantha] Length = 1716 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 R+FYP ITKLICCDQ+++RGAL DLF+ QL+ L+P Sbjct: 1682 REFYPLITKLICCDQMDVRGALGDLFSKQLTPLMP 1716 >ref|XP_006353133.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 5-like isoform X1 [Solanum tuberosum] gi|565373138|ref|XP_006353134.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 5-like isoform X2 [Solanum tuberosum] Length = 1770 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLL 102 R+FYP ITKL+CCDQ+++RG+LADLF MQL+ LL Sbjct: 1736 REFYPLITKLVCCDQMDVRGSLADLFNMQLNPLL 1769 >gb|EMT08768.1| Brefeldin A-inhibited guanine nucleotide-exchange protein 2 [Aegilops tauschii] Length = 730 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 R+FYP ITKLICCDQ+++RGAL DLF+ QL+ L+P Sbjct: 696 REFYPLITKLICCDQMDVRGALGDLFSKQLTPLMP 730 >gb|EMS61589.1| Brefeldin A-inhibited guanine nucleotide-exchange protein 2 [Triticum urartu] Length = 1554 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 R+FYP ITKLICCDQ+++RGAL DLF+ QL+ L+P Sbjct: 1520 REFYPLITKLICCDQMDVRGALGDLFSKQLTPLMP 1554 >ref|XP_004252155.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 5-like, partial [Solanum lycopersicum] Length = 1744 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLL 102 R+FYP ITKL+CCDQ+++RG+LADLF MQL+ LL Sbjct: 1710 REFYPLITKLVCCDQMDVRGSLADLFNMQLNPLL 1743 >ref|NP_001060005.1| Os07g0564700 [Oryza sativa Japonica Group] gi|34393201|dbj|BAC82915.1| guanine nucleotide-exchange protein-like [Oryza sativa Japonica Group] gi|113611541|dbj|BAF21919.1| Os07g0564700 [Oryza sativa Japonica Group] Length = 264 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 R+FYP ITKLICCDQ+++RGAL DLF+ QL+ L+P Sbjct: 230 REFYPLITKLICCDQMDVRGALGDLFSKQLTPLMP 264 >ref|XP_003560084.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 1-like [Brachypodium distachyon] Length = 1712 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 R+FYP ITKLICCDQ+++RGAL DLF+ QL+ L+P Sbjct: 1678 REFYPLITKLICCDQMDVRGALGDLFSKQLTPLMP 1712 >gb|EEE67420.1| hypothetical protein OsJ_24760 [Oryza sativa Japonica Group] Length = 1650 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 R+FYP ITKLICCDQ+++RGAL DLF+ QL+ L+P Sbjct: 1616 REFYPLITKLICCDQMDVRGALGDLFSKQLTPLMP 1650 >gb|EAY95525.1| hypothetical protein OsI_17371 [Oryza sativa Indica Group] Length = 1680 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 R+FYP ITKLICCDQ+++RGAL DLF+ QL+ L+P Sbjct: 1646 REFYPLITKLICCDQMDVRGALGDLFSKQLTPLMP 1680 >ref|XP_002309445.2| hypothetical protein POPTR_0006s23350g [Populus trichocarpa] gi|550336927|gb|EEE92968.2| hypothetical protein POPTR_0006s23350g [Populus trichocarpa] Length = 1611 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 R+FYP +TKL+CCDQ+++RGAL DLF +QL LLP Sbjct: 1577 REFYPLLTKLVCCDQMDVRGALGDLFRVQLKALLP 1611 >gb|EPS63136.1| hypothetical protein M569_11651 [Genlisea aurea] Length = 90 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +1 Query: 4 DFYPSITKLICCDQVEIRGALADLFTMQLSTLL 102 DFYPSITKLICCDQ+++R ALADLF +Q +TL+ Sbjct: 15 DFYPSITKLICCDQMDVRSALADLFAVQFTTLM 47 >ref|XP_002309444.1| predicted protein [Populus trichocarpa] Length = 275 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 R+FYP +TKL+CCDQ+++RGAL DLF +QL LLP Sbjct: 241 REFYPLLTKLVCCDQMDVRGALGDLFRVQLKALLP 275 >ref|XP_006474544.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 5-like isoform X1 [Citrus sinensis] gi|568841195|ref|XP_006474545.1| PREDICTED: brefeldin A-inhibited guanine nucleotide-exchange protein 5-like isoform X2 [Citrus sinensis] Length = 1774 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 RDFYP + +LICCDQ++IRGA+ DLF MQL LLP Sbjct: 1740 RDFYPLLVRLICCDQMDIRGAVGDLFRMQLKALLP 1774 >ref|XP_006452929.1| hypothetical protein CICLE_v10007246mg [Citrus clementina] gi|557556155|gb|ESR66169.1| hypothetical protein CICLE_v10007246mg [Citrus clementina] Length = 1461 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 RDFYPSITKLICCDQVEIRGALADLFTMQLSTLLP 105 RDFYP + +LICCDQ++IRGA+ DLF MQL LLP Sbjct: 1427 RDFYPLLVRLICCDQMDIRGAVGDLFRMQLKALLP 1461