BLASTX nr result
ID: Rehmannia24_contig00019885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00019885 (335 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW24091.1| hypothetical protein PHAVU_004G102000g [Phaseolus... 63 4e-08 gb|ESW08827.1| hypothetical protein PHAVU_009G078200g [Phaseolus... 62 8e-08 gb|EMJ10341.1| hypothetical protein PRUPE_ppa005808mg [Prunus pe... 62 1e-07 gb|EMJ10340.1| hypothetical protein PRUPE_ppa005808mg [Prunus pe... 62 1e-07 gb|ESW25384.1| hypothetical protein PHAVU_003G031100g [Phaseolus... 61 2e-07 ref|XP_004152398.1| PREDICTED: phosphatidylserine decarboxylase ... 60 4e-07 gb|ESW26261.1| hypothetical protein PHAVU_003G104300g [Phaseolus... 58 1e-06 ref|XP_004246839.1| PREDICTED: uncharacterized protein LOC101266... 58 1e-06 ref|XP_002266091.2| PREDICTED: LOW QUALITY PROTEIN: phosphatidyl... 57 2e-06 emb|CBI37364.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_004511705.1| PREDICTED: phosphatidylserine decarboxylase ... 57 3e-06 ref|XP_004511703.1| PREDICTED: phosphatidylserine decarboxylase ... 57 3e-06 gb|EOY24297.1| Phosphatidylserine decarboxylase 1 [Theobroma cacao] 57 3e-06 ref|XP_004248993.1| PREDICTED: uncharacterized protein LOC101261... 57 3e-06 gb|ESW29271.1| hypothetical protein PHAVU_002G0572001g, partial ... 56 6e-06 gb|ESW29270.1| hypothetical protein PHAVU_002G0572001g, partial ... 56 6e-06 ref|XP_004248607.1| PREDICTED: uncharacterized protein LOC101247... 56 6e-06 >gb|ESW24091.1| hypothetical protein PHAVU_004G102000g [Phaseolus vulgaris] Length = 168 Score = 63.2 bits (152), Expect = 4e-08 Identities = 23/42 (54%), Positives = 36/42 (85%) Frame = +1 Query: 208 MDKSWIELRRNTHEYLEGVNQFIDFALEHRSIDGRILCPCVK 333 MDKSWI + RNT +Y++G+N+F+DFA ++S++G+I+CPC K Sbjct: 1 MDKSWINMPRNTCQYMDGLNKFLDFAFANKSVEGKIICPCPK 42 >gb|ESW08827.1| hypothetical protein PHAVU_009G078200g [Phaseolus vulgaris] Length = 136 Score = 62.0 bits (149), Expect = 8e-08 Identities = 22/42 (52%), Positives = 36/42 (85%) Frame = +1 Query: 208 MDKSWIELRRNTHEYLEGVNQFIDFALEHRSIDGRILCPCVK 333 MDKSWI + RNT +Y++G+N+++DFA ++S++G+I+CPC K Sbjct: 1 MDKSWINMPRNTCQYMDGLNKYLDFAFANKSVEGKIICPCPK 42 >gb|EMJ10341.1| hypothetical protein PRUPE_ppa005808mg [Prunus persica] Length = 443 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/56 (48%), Positives = 39/56 (69%), Gaps = 5/56 (8%) Frame = +3 Query: 57 PLTVCLLKGLFYCIIY*KLEDYHQIHSPVDWNILL-----GRCL*INVHDSQVIRD 209 P++ C +KGLFYC+IY K DYH+IH+P DWN+L+ GR L +N ++ IR+ Sbjct: 261 PVSTCPIKGLFYCVIYLKPGDYHRIHAPADWNVLVRRHFSGRLLPVNERATRTIRN 316 >gb|EMJ10340.1| hypothetical protein PRUPE_ppa005808mg [Prunus persica] Length = 443 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/56 (48%), Positives = 39/56 (69%), Gaps = 5/56 (8%) Frame = +3 Query: 57 PLTVCLLKGLFYCIIY*KLEDYHQIHSPVDWNILL-----GRCL*INVHDSQVIRD 209 P++ C +KGLFYC+IY K DYH+IH+P DWN+L+ GR L +N ++ IR+ Sbjct: 261 PVSTCPIKGLFYCVIYLKPGDYHRIHAPADWNVLVRRHFSGRLLPVNERATRTIRN 316 >gb|ESW25384.1| hypothetical protein PHAVU_003G031100g [Phaseolus vulgaris] Length = 134 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/42 (54%), Positives = 34/42 (80%) Frame = +1 Query: 208 MDKSWIELRRNTHEYLEGVNQFIDFALEHRSIDGRILCPCVK 333 MDKSWI++ RNT +Y+EG+N+F+DFA + + G+I+CPC K Sbjct: 1 MDKSWIDMPRNTLKYMEGLNKFLDFAFANNGVRGKIICPCQK 42 >ref|XP_004152398.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like [Cucumis sativus] gi|449488662|ref|XP_004158135.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like [Cucumis sativus] Length = 442 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +3 Query: 21 FWQCKVLHD-ALAPLTVCLLKGLFYCIIY*KLEDYHQIHSPVDWNILLGR 167 +W+ + + L P++ C +KGLFYC+IY K DYH+IHSPVDW +L+ R Sbjct: 251 WWKISLAYPKVLDPVSTCPVKGLFYCVIYLKPGDYHRIHSPVDWQVLVRR 300 >gb|ESW26261.1| hypothetical protein PHAVU_003G104300g [Phaseolus vulgaris] Length = 69 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/42 (52%), Positives = 35/42 (83%) Frame = +1 Query: 208 MDKSWIELRRNTHEYLEGVNQFIDFALEHRSIDGRILCPCVK 333 MDKSWI + RNT +Y++G+N+F+DFA +++I+G+I+ PC K Sbjct: 1 MDKSWINMPRNTCQYMDGLNKFLDFAFANKTIEGKIIFPCPK 42 >ref|XP_004246839.1| PREDICTED: uncharacterized protein LOC101266258 [Solanum lycopersicum] Length = 471 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = +1 Query: 211 DKSWIELRRNTHEYLEGVNQFIDFALEHRSIDGRILCPCVK 333 DKSWI LRR+T+EY++GVN F+D A E S ILCPC K Sbjct: 5 DKSWINLRRSTNEYIDGVNDFLDKAFERASQGNEILCPCKK 45 >ref|XP_002266091.2| PREDICTED: LOW QUALITY PROTEIN: phosphatidylserine decarboxylase proenzyme 1, mitochondrial-like [Vitis vinifera] Length = 436 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 5/56 (8%) Frame = +3 Query: 57 PLTVCLLKGLFYCIIY*KLEDYHQIHSPVDWNILL-----GRCL*INVHDSQVIRD 209 P+ +KGLFYC+IY K DYH+IHSP+DWN+L+ GR +N ++ IR+ Sbjct: 255 PVASSPMKGLFYCVIYLKPGDYHRIHSPIDWNVLVRRHFSGRLFPVNERATRTIRN 310 >emb|CBI37364.3| unnamed protein product [Vitis vinifera] Length = 427 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 5/56 (8%) Frame = +3 Query: 57 PLTVCLLKGLFYCIIY*KLEDYHQIHSPVDWNILL-----GRCL*INVHDSQVIRD 209 P+ +KGLFYC+IY K DYH+IHSP+DWN+L+ GR +N ++ IR+ Sbjct: 255 PVASSPMKGLFYCVIYLKPGDYHRIHSPIDWNVLVRRHFSGRLFPVNERATRTIRN 310 >ref|XP_004511705.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like isoform X3 [Cicer arietinum] Length = 438 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +3 Query: 57 PLTVCLLKGLFYCIIY*KLEDYHQIHSPVDWNILLGR 167 P + C KGLFYC+IY K DYH+IHSP DWNIL+ R Sbjct: 256 PTSSCPKKGLFYCVIYLKPGDYHRIHSPTDWNILVRR 292 >ref|XP_004511703.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like isoform X1 [Cicer arietinum] gi|502160311|ref|XP_004511704.1| PREDICTED: phosphatidylserine decarboxylase proenzyme-like isoform X2 [Cicer arietinum] Length = 491 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +3 Query: 57 PLTVCLLKGLFYCIIY*KLEDYHQIHSPVDWNILLGR 167 P + C KGLFYC+IY K DYH+IHSP DWNIL+ R Sbjct: 309 PTSSCPKKGLFYCVIYLKPGDYHRIHSPTDWNILVRR 345 >gb|EOY24297.1| Phosphatidylserine decarboxylase 1 [Theobroma cacao] Length = 462 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/46 (54%), Positives = 32/46 (69%) Frame = +3 Query: 30 CKVLHDALAPLTVCLLKGLFYCIIY*KLEDYHQIHSPVDWNILLGR 167 C + D L P+ KGL+YC+IY K DYH+IHSPVDWN+L+ R Sbjct: 277 CWTIQDILFPM-----KGLYYCVIYLKPGDYHRIHSPVDWNVLVRR 317 >ref|XP_004248993.1| PREDICTED: uncharacterized protein LOC101261078 [Solanum lycopersicum] Length = 534 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/41 (58%), Positives = 30/41 (73%) Frame = +1 Query: 211 DKSWIELRRNTHEYLEGVNQFIDFALEHRSIDGRILCPCVK 333 DKSW+ LRR+T+EY++GVN F+D A E S ILCPC K Sbjct: 5 DKSWMNLRRSTNEYIDGVNDFLDKAFERASQGNEILCPCKK 45 >gb|ESW29271.1| hypothetical protein PHAVU_002G0572001g, partial [Phaseolus vulgaris] Length = 318 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 5/56 (8%) Frame = +3 Query: 57 PLTVCLLKGLFYCIIY*KLEDYHQIHSPVDWNILL-----GRCL*INVHDSQVIRD 209 P + C +GLFYC++Y K DYH+IHSP DWNIL+ GR +N ++ IR+ Sbjct: 256 PKSSCPKRGLFYCVVYLKPGDYHRIHSPADWNILVRRHFSGRLYPLNERATRTIRN 311 >gb|ESW29270.1| hypothetical protein PHAVU_002G0572001g, partial [Phaseolus vulgaris] Length = 236 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 5/56 (8%) Frame = +3 Query: 57 PLTVCLLKGLFYCIIY*KLEDYHQIHSPVDWNILL-----GRCL*INVHDSQVIRD 209 P + C +GLFYC++Y K DYH+IHSP DWNIL+ GR +N ++ IR+ Sbjct: 174 PKSSCPKRGLFYCVVYLKPGDYHRIHSPADWNILVRRHFSGRLYPLNERATRTIRN 229 >ref|XP_004248607.1| PREDICTED: uncharacterized protein LOC101247967 [Solanum lycopersicum] Length = 413 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +1 Query: 211 DKSWIELRRNTHEYLEGVNQFIDFALEHRSIDGRILCPCVK 333 DKSW+ LRR+T+EY+ GVN F+D A E S ILCPC K Sbjct: 5 DKSWMNLRRSTNEYIHGVNDFLDKAFERASQGNEILCPCKK 45