BLASTX nr result
ID: Rehmannia24_contig00019613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00019613 (730 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71838.1| hypothetical protein M569_02915, partial [Genlise... 67 6e-09 >gb|EPS71838.1| hypothetical protein M569_02915, partial [Genlisea aurea] Length = 688 Score = 67.0 bits (162), Expect = 6e-09 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = -1 Query: 256 ITSTAESWEILSLAHKLSVILEHLQRQLEICKDLIGRKKVEDAYVAFKRLID 101 I+S AESWEI +LAHKLSVILEHL +QL +CK+LI +KK D + F L D Sbjct: 238 ISSPAESWEIRNLAHKLSVILEHLHKQLRVCKELIDQKKTNDKFNEFVSLTD 289