BLASTX nr result
ID: Rehmannia24_contig00018175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00018175 (531 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF64710.1| putative transposase [Ipomoea tricolor] 43 1e-06 >dbj|BAF64710.1| putative transposase [Ipomoea tricolor] Length = 517 Score = 42.7 bits (99), Expect(2) = 1e-06 Identities = 15/42 (35%), Positives = 29/42 (69%) Frame = -2 Query: 149 IRYKLEIQVVDNTGNVPLLLWDRDCEKLIGKPCAILRSEHMD 24 +RY+++++ VD GN P +LWD++C +L+G LR + ++ Sbjct: 343 LRYRVKVRAVDLDGNAPFILWDKECTELLGISATDLRQKILE 384 Score = 35.0 bits (79), Expect(2) = 1e-06 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = -3 Query: 382 GSFWICGTIISFVG--DWWYLSCPH--CPKKLKEAGEKLYCFGCDKFPENGNLRY 230 G FW+ I+ DW+Y+SC C KKL C C + + G LRY Sbjct: 291 GDFWVAAKIVGIESSWDWFYVSCKSHGCNKKLTLRNTLYDCDKCKRTWQEGILRY 345